KEGG   Anaerolinea thermophila: ANT_03940Help
Entry
ANT_03940         CDS       T01410                                 

Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00480  Glutathione metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01130  Biosynthesis of antibiotics
atm01200  Carbon metabolism
atm01210  2-Oxocarboxylic acid metabolism
atm01230  Biosynthesis of amino acids
Module
atm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_03940
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ANT_03940
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ANT_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAJ62428
NITE: ANT_03940
UniProt: E8N0N3
LinkDB All DBs
Position
complement(428614..429894)
Genome map
AA seq 426 aa AA seqDB search
MSESGERITMQNGRLHVPSHPIIPFIIGDGTGPDIWRAAVRVFDAAVEKAYRGERRIIWK
EVLAGEKAFNTLGTWLPEETLQAFREYLVGIKGPLTTPIGGGIRSLNVALRKELDLYVCL
RPVRYFPGVPSPVRHPELVDMVIFRENTEDIYTGIEYEYGTEENARFKQLLKEHFPKDYA
KIRFPETAGIGIKPVSKEGTARLVRAAIRYALENKRRNVTLVHKGNIMKYTEGAFRNWGY
EVAETEFGEQTYTWAQWERTKAEKGEDSANAEQEAALKSGKLLVKDVIADIVFQQTLLRP
REFDVLATMNLNGDYLSDALAAQVGGIGIAPGGNINYTTGHAVFEATHGTAPKYADKDMV
NPGSVILSGEMMLRYMGWTEAADLIIRGMEGAIAAKTVTYDFHRLMEGATLLKCSEFGDA
VIRHMD
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatctggcgaacgcattaccatgcaaaacggacgcctgcacgtcccgtctcac
cccatcattccttttattatcggcgatggcaccggaccggacatctggcgcgcggcggtg
cgcgtctttgatgcggcggtggagaaagcctatcgcggcgaacggcgcatcatctggaaa
gaggtgctggcgggcgaaaaagcctttaacacgctgggcacctggctccccgaggaaacc
ctgcaggcatttcgcgagtatctggtgggcattaaaggtccgctgaccactcccatcggc
gggggcatccgctcgctgaacgttgccctgcgcaaggaactggatttgtacgtctgtctg
cgaccggtgcgttacttcccgggcgtgcccagtccggtgcgccaccccgaactggtggac
atggtcatcttccgcgagaacaccgaggacatctacaccggcatcgagtacgagtacggc
accgaggaaaacgcccgcttcaagcaactgctcaaagagcatttccccaaagactacgcc
aaaatccgcttccccgagacggcgggtatcggcatcaagccggtttcaaaggaaggcacg
gcgcggctggtgcgcgccgccatccgctatgcgctggagaacaaacgccgcaatgtgact
ctggtgcataagggcaacatcatgaagtacaccgagggggctttccgcaactggggctac
gaagttgccgaaaccgaatttggcgagcagacctacacctgggcgcagtgggagcgcacc
aaagccgaaaaaggcgaagattccgccaacgccgaacaggaagccgcgctgaaatccggg
aaactgctcgtcaaggacgtgattgccgatatcgtcttccagcagacgcttttgcgcccg
cgcgagttcgatgtgctggcaaccatgaacctcaacggcgactacctctccgacgcgctg
gcggcgcaggtgggcggcatcggcattgcgccgggcggaaacatcaactacaccaccggg
cacgccgtctttgaagccacgcacggcacggcgcccaaatacgccgataaggacatggtc
aaccccggctcggtgattctctccggcgagatgatgctgaggtacatgggctggacggaa
gccgccgacctgatcatccgcggcatggaaggcgccatcgccgccaaaacggtgacctat
gatttccaccgcctgatggaaggcgctaccctgctgaaatgctcggagttcggcgacgcc
gtcatccgccacatggattaa

DBGET integrated database retrieval system