KEGG   Anaerolinea thermophila: ANT_13110Help
Entry
ANT_13110         CDS       T01410                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
atm  Anaerolinea thermophila
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ANT_13110 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ANT_13110 (alr)
Enzymes [BR:atm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ANT_13110 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:atm01011]
 Precursor biosynthesis
  Racemase
   ANT_13110 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
1472714..1473826
Genome map
AA seq 370 aa AA seqDB search
MDHADLTTWLEIDLSVIRKNIRLLQEIAGVPVMAVVKANAYGHGLIEASRAAVQAGVQWL
GVARIDEALELHRAGIRAHPIVLGYTPPERAGEAAQAGVRLAVYDSQVAQAYAAQAKAVG
KPLYVHAKFDTGMGRLGASPEEGVEWMRWLHTLEGLQVEGAFTHLAEADDPQKPTTHWQL
DRFDKLLSGLESAGLRPAWVHAANSAGALYFPRARYNLVRTGIAIYGLNPSAHAPLPEGF
RPALTWKTRLTSVKIFPPNHGISYNYRYRTKSEERIGVCAVGYADGFRRQMGNMVLVRGR
RVPVVGSVCMDQCMVNLDQVPEAQMGDEVVLIGQQGNDEITAEERAHEWGTIHYEVVCGL
ANRLPRIYVE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgcagatcttacaacgtggcttgaaattgatctcagtgtcatccgtaaaaat
attcgtctgttacaagaaatcgctggtgtgcctgtgatggcagtggtcaaagccaatgcc
tatggacatggcttaatagaagccagccgtgctgcagttcaggcgggtgttcaatggtta
ggggttgctcgcattgacgaggctctggaactccatcgcgcagggattcgcgctcatcca
attgtgctgggctacactcctcctgaacgtgccggggaagcggcacaggcaggggtgcgc
cttgctgtctacgattcccaggttgcgcaagcctacgcggctcaggcaaaagcagtgggc
aagcctctctacgtccatgcaaaatttgatactggcatgggaagattgggagcctcgccg
gaggaaggggtggaatggatgcgctggctccatactctggaggggttgcaggtagaagga
gcttttacccatcttgccgaagccgatgatccgcaaaagcctacgactcactggcagttg
gaccgtttcgacaaattgctttccgggttagaatctgcggggttgcgtcctgcctgggtg
catgcggcaaactcggctggggcgttgtatttccctcgagcccgctataacctcgttcgt
acaggaatagccatctatgggcttaatccttctgcccatgcgcctttacccgaaggtttt
cggcctgcactaacctggaaaacacgcttgacttctgtaaagatcttcccgcccaatcat
ggaatcagttataactaccgctaccgtaccaagtctgaggaacggattggggtatgtgcc
gtggggtatgccgatggttttcgccgtcaaatggggaacatggttttagtacgcgggaga
agggtgccggttgtgggtagtgtatgtatggatcagtgcatggtcaaccttgatcaggtt
cccgaggcacagatgggcgatgaggtggtgctgatcggtcagcaaggcaatgacgaaatt
actgctgaagaacgtgctcatgaatggggcaccattcactacgaggtcgtttgtgggttg
gcaaatcgtctgccgcgtatttatgtggagtga

DBGET integrated database retrieval system