KEGG   Amborella trichopoda: 18427677Help
Entry
18427677          CDS       T02990                                 

Definition
(RefSeq) pentatricopeptide repeat-containing protein At4g16470
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
atr  Amborella trichopoda
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    18427677
Enzymes [BR:atr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     18427677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MSYSAFRPSVLHNYLHYPYSGFAKEVKNLCISGRLKEAIQKLWRKGPLMVSSDSYASLLQ
ECINLKAFKLGRMVHAHMVVNGFSPDQYLRTKLVILYTKNRDLRTAHQLFIRMEERSLVS
WNSMISGYVQISRFEKALELFFNMQLSSLVPDQFTFAPVFRACAQLAMLEQGRRIHAISI
KRETKDNLVIATALIDMYCKCSSYEDARLVFDRMHERNVITWTALIVGYGQHGRGGEVFK
LFREMVDAGFKPNYITFLAILCACSHRGLVNEGLEYFDLMVQHYKIRPRAEHCSAIVDLL
GRAGRVNEAFEFAERLAFLDHSVIWGALLNACLWRDVSVVREMMRINRVKKESVAVIKSD
KDNRYGLNSIVTHDGEKMSCWAMADLLTFKTKLGFDAYSKLDVIGIDEAQFFGDLYDFCR
MAADYDGKTLIVAGLDGDYLRKSFGSMLDIIPLADSVTKLTASCELCGKKAFFTLRKTGD
TQKELIGGADIYMPVCRQHYVSGQVVIEAARNVLESQQIQEDVYLEAAPLSSQLVPS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcctactcagcattcagaccctcagttctccacaattatctgcactatccctactct
ggttttgctaaagaggtaaagaacctatgcatatcaggcagattaaaagaagcaatacaa
aagttatggaggaaaggtccattaatggtgagctctgattcctatgcctctcttttacag
gaatgcatcaatctaaaagcttttaaacttggccgaatggtccatgctcacatggtggtt
aatgggttctctcctgatcaatatctaagaaccaaattggttattctctatactaaaaat
cgtgatttacgaactgcacaccagttgtttattagaatggaagagagaagtttagtttca
tggaattctatgatttcgggttatgttcaaatcagtcgattcgaaaaggctctagagctc
ttttttaatatgcaattgagcagtttggtacctgatcagttcacttttgctcctgtcttt
cgagcttgtgctcaattggccatgcttgaacaaggtagaagaatccatgcaatttctatt
aagagagagactaaggacaacttggtcattgctactgcactcattgacatgtattgcaag
tgtagtagctacgaggatgcgcgtttggtcttcgataggatgcatgagaggaatgtaatt
acgtggactgcccttatagtgggttatggccaacatgggcgagggggagaagttttcaag
ctctttagagagatggtagatgctggttttaagcccaattatattacgttcttggctatt
ctatgtgcttgtagccatcgtgggttggtcaatgaaggtttagaatattttgatttaatg
gttcaacattataagattaggcctagagctgaacattgttcagccattgttgaccttttg
gggcgagcaggtagggtaaatgaggcctttgaatttgcagagaggttggctttcttggat
cactctgttatttggggtgctttgcttaatgcttgtctgtggagagatgtttcagttgta
agagaaatgatgagaattaatagagtgaaaaaggaaagtgtggcggtcataaaatctgac
aaagataaccgatacggattgaattctatagttacccatgatggtgagaaaatgtcttgc
tgggctatggctgatctcttaactttcaaaacaaagttggggtttgatgcgtacagtaag
ttggatgtaatagggattgatgaagctcaattctttggggacctttatgatttttgtcgg
atggcagctgactatgatggcaagactctaattgttgcgggtctagatggcgattacttg
aggaagagctttggatccatgcttgatatcatccctttagctgattctgttactaaatta
acagccagctgtgagctctgtggaaagaaggcctttttcacgctacgaaagactggagat
acacaaaaggagctaattggtggagccgatatctatatgccagtttgtaggcagcattat
gtcagtggccaagttgttattgaagctgctagaaatgtcctggaatctcaacagattcaa
gaggatgtttatctagaggcagctccactatcaagtcaacttgttccctcttga

DBGET integrated database retrieval system