KEGG   Amborella trichopoda: 18438989Help
Entry
18438989          CDS       T02990                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
atr  Amborella trichopoda
Pathway
atr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    18438989
Enzymes [BR:atr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     18438989
Transporters [BR:atr02000]
 Other Transporters
  Pores ion channels [TC:1]
   18438989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_N_4 GST_C_2
Motif
Other DBs
NCBI-GeneID: 18438989
NCBI-ProteinID: XP_006849226
UniProt: W1PLC7
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MEGQKVRLLGAWGSPFVHRVELALKLKGIEYEFIEEDLKNKSPLLLESNPVHKKIPVLIH
GNNPVSESTVILEYIDETWPEIPILPKDPYERAQARFWAKFIDDKCLPVSWIAFTTQGGQ
QEKALKEAQECIKTLEAALKAKFFGGETIDYVDVVGNFLGYWMRILGEAAGIQYYDAEKA
PVFHSWIEEFTSVDVVKESLPTHDKLLAYFKGHLEALHSTSTSS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggaagggcaaaaagtaaggttgctgggagcatggggtagtccctttgttcacagagtt
gaactggccctcaaactcaagggaattgagtatgagttcattgaagaagatctcaaaaac
aagagcccccttctcttggagtctaaccctgttcacaagaagatccctgtgctcattcat
ggcaataatcccgtgtccgaatcaacggtgattttggaatacatagatgaaacatggcct
gaaattcccattttgccaaaggatccatatgagagggcccaagctcgtttctgggctaag
ttcatcgatgataagtgcctgcctgtctcttggatagctttcactacgcaagggggacaa
caagagaaggctctcaaggaggcccaagagtgcataaaaaccctagaagcagccctaaag
gcgaagtttttcggcggagaaacaatcgattacgtcgacgttgtcggaaattttttaggc
tattggatgagaatattaggggaagctgcaggtattcagtattacgatgctgagaaagca
ccagtcttccattcatggatagaagaattcacgagcgttgatgttgtaaaggaaagcctt
ccaactcatgataagcttcttgcttactttaaaggtcatcttgaggccttacactctacc
tcaacttcctcctaa

DBGET integrated database retrieval system