KEGG   Amborella trichopoda: 18444667Help
Entry
18444667          CDS       T02990                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 2
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
atr  Amborella trichopoda
Brite
Enzymes [BR:atr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     18444667
Chromosome [BR:atr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     18444667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MAATRSSASAAAATSAEIVVEDMKRKRILSSKLYFDVPPNKVPVVYSPSYDISFMGIEKV
HPFDSSKWGRICQFLVVEGFLDKNRLVEPLEASKDDLLVVHTEEYLKSLRSSLNVSLIIE
VPPVAVFPNCILQMKVLKPFRSQVGGTILAGKLALERGWAINVGGGFHHCSSDKGGGFCA
YADITLCVEFAFTRLGVSRVMIIDLDAHQGNGHEWDFANDGRVYIFDMYNRNIYPHDFEA
RRFIDQKVELQSGTTTEEYLERLNKELQVAQSAFDPELVIYNAGTDILDGDPLGRLKVSP
QGVIIRDEKVFCFAQEKRVPLVMVTSGGYMKTSARVIADSISNLHNKHLIDLDGTLQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccgccactcggtcctcggcttctgctgctgctgccacttccgctgaaatagttgtc
gaagacatgaagaggaaacggattctgtcctctaaactctattttgacgtgcctcccaac
aaagttcctgtcgtttattcaccttcctatgacatatcgtttatggggatcgagaaagtg
cacccgtttgattcttcaaaatggggacgtatctgccagtttcttgttgtggaaggtttt
ttggataaaaaccgacttgtagaaccattagaagcttcgaaggatgacttactagtggtg
cacactgaagaatatttgaaaagtctaagaagtagtttgaatgttagtcttatcatagag
gttcctccggttgcagtctttcctaattgtattctgcagatgaaagtacttaaaccattc
cgcagtcaggtgggtggtacaatcttggcaggaaagcttgcattagaaaggggttgggcc
attaatgttggtggtggttttcatcactgttcatcagataaaggtggcggattttgtgca
tatgcagatataactctctgcgttgaatttgcatttacacgtttaggtgtttcacgggtc
atgattattgatcttgatgcacatcaagggaatggccatgagtgggactttgctaatgat
ggaagagtttatattttcgatatgtacaacaggaacatttacccccatgattttgaggcc
aggagattcattgatcaaaaggttgaactgcagtctggaaccaccacagaggagtacttg
gaaaggttaaacaaagagcttcaggtcgcccaatctgcatttgatccagagttggttata
tacaatgcaggaactgacatcctagatggtgatcccttgggcagattgaaggttagccca
cagggcgttattatccgggatgaaaaggtgttttgttttgcacaagaaaagagagtacca
cttgtcatggttacttcaggtgggtatatgaagaccagtgcacgagtaatagcagattca
atatcaaatctccataataaacatttgatagacttggatggtaccttgcaataa

DBGET integrated database retrieval system