KEGG   Aegilops tauschii (wheat D): 109732741Help
Entry
109732741         CDS       T04345                                 

Gene name
LOC109732741
Definition
(RefSeq) beta-galactosidase 8 isoform X1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00052  Galactose metabolism
ats00511  Other glycan degradation
ats00531  Glycosaminoglycan degradation
ats00600  Sphingolipid metabolism
ats00604  Glycosphingolipid biosynthesis - ganglio series
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109732741 (LOC109732741)
  Lipid metabolism
   00600 Sphingolipid metabolism
    109732741 (LOC109732741)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    109732741 (LOC109732741)
   00604 Glycosphingolipid biosynthesis - ganglio series
    109732741 (LOC109732741)
   00511 Other glycan degradation
    109732741 (LOC109732741)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     109732741 (LOC109732741)
Exosome [BR:ats04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109732741 (LOC109732741)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: XP_020147513
LinkDB All DBs
Position
Unknown
AA seq 674 aa AA seqDB search
MASAGSFGRLSLLLALSLCSALASTVPGEAPRRFWIEGDAFWKDGARFQIVGGDVHYFRI
VPEYWKDRLLRAKALGLNTIQTYVPWNLHEPEPQSWEFKGFADIESYLRLAQELEMLVML
RVGPYICGEWDLGGFPPWLLTIEPALKLRSSDSTYLFLVERWWRVLLPKVAPLLYENGGP
IIMVQIENEFGSFGDDKNYLHYLVQLARRYLGNDIVLYTTDGGTTNTLKNGAILQDDVFA
AVDFSTGDDPWPIFRLQKKYNLPGKSAPLSAEFYTGWLTHWGESIATTTASSTAKALKSI
LCRNGSAVLYMAHGGTNFGFYNGANTGQTEFEYKADLTSYDYDAPIKEHGDVHNPKYKAL
RRVIHECTGTPLHPLPADIERASYGLVKLQKVASFFDIFDKICDPLKVAVSEQPLSMELT
GQMFGFLLYVSEYQGKGPYSILSIPKVHDRAQVFVSCSLDDVRNQIYAGVIERWSSKTLQ
IPTLNCSSNIRLSILVENMGRVNYGPYIFDQKGILSTVEIDGVTLHHWKMYPLSFNLLDN
LSKFQPIQQITDARASKVSSHGGSQTKLRDLSFYLNGNSEEPEFYEGHFHIDSNSTIKDT
FISFRGWNKGVAFVNNFNIGRFWPVMGPQCALYVPAPILRSGDNIVVIFELHVPNPERTI
NLVKDPDFTCGPNR
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgccggaagcttcgggaggctctctcttctcctcgcgctctcgctgtgctcc
gcgctcgcatccacggtccccggcgaggctccgaggaggttctggatcgagggcgacgcc
ttctggaaggacggggcacggttccagatcgtcggcggcgacgtgcactacttccgcatt
gtccccgagtactggaaagatcgccttttaagggctaaggcactgggcctgaacacaatt
caaacatatgttccttggaatttgcacgagccggaaccacagagctgggaattcaagggt
ttcgctgacattgaatcgtatctaagacttgctcaagaattagaaatgctcgtcatgctt
cgtgtaggtccatatatttgtggagaatgggatttagggggatttccaccatggttgctc
accatagaaccagcccttaaactgcgatcatcagactcaacctatcttttcttggtagag
agatggtggagagtcttgctcccaaaagtagcaccactgttatacgagaatggaggtcca
attatcatggtgcagattgaaaatgaatttggttcatttggagatgacaagaattacctt
cattaccttgttcagttggccagacgatatctggggaatgacattgttctgtatacaact
gatgggggcactactaataccttaaagaatggagcaattcttcaagatgatgtcttcgct
gctgttgatttttcaactggtgatgatccatggccaatattcagattacagaagaaatat
aacttaccgggaaaatcagcccctttaagtgcggaattttataccggatggctaacacac
tggggtgagagtattgccacaacaactgccagcagcacagctaaagctcttaaaagtatt
ctatgccgcaatggttctgctgtactctatatggctcatggagggacaaattttgggttt
tacaatggagcaaatactggtcaaactgaattcgagtataaggcagacctcacatcttat
gattatgatgcgccaattaaggagcatggagacgtgcataatcccaaatacaaagcattg
agaagagtaatacatgaatgcactggcacacctctgcatccacttcctgccgacattgaa
agagcaagttatgggcttgtgaaattacaaaaggttgcttctttctttgacatatttgat
aagatctgtgatccactgaaagtggctgtttcagaacagcctctgtctatggaactgaca
ggccagatgtttgggtttctactgtatgtgtcggaataccaaggaaaaggtccttacagc
atcctatcaattccaaaggtacatgacagagcccaggtgtttgtgtcatgctcacttgat
gacgtcagaaatcaaatatatgctggcgttattgaaagatggtctagtaaaaccctacag
ataccaaccttaaactgctcttctaatatccgcttatctatcctggtagaaaatatgggc
cgtgtaaattatgggccatacatttttgaccagaaggggatattatctactgttgaaata
gatggtgtgactctccatcactggaaaatgtacccgttatcgttcaatttactggacaac
ctttcgaaattccaaccaatccagcagatcactgatgccagagctagcaaagtgtccagt
catggtggttcacaaactaagctacgtgatttgtcattctatctaaatggcaattcagaa
gagccagaattttatgaaggccatttccacattgactccaatagcacgataaaggataca
ttcatatcattccgtggttggaacaaaggggttgcttttgtgaacaacttcaacatcgga
aggttctggccggtaatgggaccgcagtgcgctctttatgttcctgctccaatcctcaga
tctggagacaacattgttgtaatcttcgaactgcatgttccaaatcctgagcgtactatc
aacttggtaaaagatccagatttcacgtgcggtccaaatcgatga

DBGET integrated database retrieval system