KEGG   Aegilops tauschii (wheat D): 109751606Help
Entry
109751606         CDS       T04345                                 

Gene name
LOC109751606
Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00250  Alanine, aspartate and glutamate metabolism
ats00410  beta-Alanine metabolism
ats00430  Taurine and hypotaurine metabolism
ats00650  Butanoate metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    109751606 (LOC109751606)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109751606 (LOC109751606)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109751606 (LOC109751606)
   00430 Taurine and hypotaurine metabolism
    109751606 (LOC109751606)
Enzymes [BR:ats01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109751606 (LOC109751606)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: XP_020166077
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MVLSHAASAGSSDDSVHSTFASRYVRASLPRFRMPENSIPKEAAYQIINDELMLDGNPRL
NLASFVTTWMEPECNKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGETETA
VGVGTVGSSEAIMLAGLAFKRRWQNKMKAAGKPCDKPNIVTGANVQVCWEKFARYFEVEL
KEVKLSEGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKMLNDLLVKKNEETGWD
TPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWCIWRSKEDLPD
ELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNIMDNCQENAMVLKEGL
ERTGRFNIVSKDQGVPLVAFSLKDSSRHDEFEISEFLRRFGWIVPAYTMPPDAQHVTVLR
VVIREDFSRTFAERLVIDIEKVLHELDALPSRSSGPALQHPNGDTVSEKDLARQREVVSV
WKRAVAARKKTQGVC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcccacgccgcgtcggctggatcctccgatgactccgtgcactccaccttc
gcctcccgctacgtccgcgcctccctgcccaggttccggatgccggagaactcgatcccg
aaggaggcggcgtaccagatcatcaacgacgagctgatgctggacgggaacccgcggctg
aacctggcgtccttcgtcaccacgtggatggagcccgagtgcaacaagctcatgatggac
tccatcaacaagaactacgtcgacatggacgagtaccccgtaaccacagagctccagaac
cgatgtgtgaacatgatcgcgcatctgttcaatgctcctctcggggagaccgagacggcc
gtgggagtgggcaccgtcggctcttcggaggccatcatgctcgccgggctggccttcaag
aggcgttggcagaacaagatgaaggccgccggcaagccctgcgacaagcccaacatcgtc
accggcgccaacgtgcaggtttgctgggagaagttcgcgcgctacttcgaggtggagctc
aaggaagtgaagctgagcgaggggtactacgtgatggaccccgagaaggccgttgagatg
gtcgacgagaacaccatctgcgtcgccgccatcctcggctccaccctcaacggcgagttc
gaggacgtcaagatgctcaatgacctcctcgtcaagaagaacgaggagacaggctgggac
acgccgatccacgtggacgcggcgagcggcgggttcatcgcgccgttcctgtacccggag
ctggagtgggacttccggctgccgctggtgaagagcatcaacgtgagcgggcacaaatac
ggcctcgtctacgccgggatcgggtggtgcatctggaggagcaaggaggacctgccggac
gagctcatcttccacatcaactacctcggcgccgaccagcccaccttcaccctcaacttc
tccaaaggttcaagccaggttatcgcgcagtattaccagctgatccgccttggtttcgag
gggtacagaaacatcatggacaactgccaggagaacgcgatggtgctcaaggaggggctg
gagcgcacgggccggttcaacatcgtgtccaaggaccagggcgtccccctggtggccttc
tccctcaaggacagcagccggcacgacgagttcgagatctccgagttcctgcgccgcttc
ggctggatcgtgcccgcctacaccatgccccccgacgcgcagcacgtcaccgtgctccgc
gtcgtcatccgcgaggacttcagccgcaccttcgccgagcgcctcgtcatcgacatcgag
aaggtgctccacgagctcgacgcgctcccctcgcgcagcagcgggcccgccctgcagcac
cccaacggcgacacggtgagcgagaaggacctcgccaggcagcgcgaggtggtgtccgtc
tggaagagggccgtcgccgccaggaagaagactcagggcgtctgctga

DBGET integrated database retrieval system