KEGG   Aegilops tauschii (wheat D): F775_14308Help
Entry
F775_14308        CDS       T04345                                 

Definition
(GenBank) Hexokinase-6
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F775_14308
   00051 Fructose and mannose metabolism
    F775_14308
   00052 Galactose metabolism
    F775_14308
   00500 Starch and sucrose metabolism
    F775_14308
   00520 Amino sugar and nucleotide sugar metabolism
    F775_14308
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    F775_14308
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     F775_14308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MAKGAVAGTAVVVSRRRRRTRDAEASRRKKMADVIEELEQTLATPTPLLRGIADAMVEEM
ERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVLRVQLGGKEKRAVQQYE
EVPIPPHLMVGTSTELFDFIAAELERFVETEGDDFHLPEGRHRELGFTFSFPVHQTSISS
GTLVKWTKGFCINGTVGEDVVAELSSAMERQGLDMKVTALVNDTVGTLAGGIYADNDVVA
AVILGTGTNAAYVEHVDAIPKWKGPLPRSGNMVINMEWGNFKSDKLPRSDYDIALDFESL
NPGEQMYEKMISGMYLGEVVRRILLRLAHDASLFGDVVPSKLEKLFVLRTPDMSAMHHDT
SHDLKHLGAKLKDILGVADTSLEARYITLHVCDKVAERGARLAAAGIYGIVKKLGRDRAP
TDGSPKQRTVVAIDGGLYEHYKKFSSRVEATVAELLGEAAASSVVVKMANDGSGIGAALL
AASHSQYNVVE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagggggcggtcgcggggacggcggtggtggtgtcgcggaggaggaggaggacg
cgggacgcggaggcgagcaggcggaagaagatggccgacgtcatcgaggagctggagcag
acgttggcgacgccgacgccgctgctgcgcggcatcgcggacgccatggtggaggagatg
gagcgcgggctgcgcgccgacccccacgcgccgctcaagatgctcatcagctacgtcgac
aatctgcccaccggggatgagcatgggctgttttatgcactggatcttggtgggaccaac
tttcgtgttctacgggttcagcttggaggaaaggagaaacgtgctgtccaacaatatgaa
gaggtgcccattccacctcatctgatggttgggacttccaccgaactatttgatttcatt
gcggctgagctagaaagatttgttgagactgaaggagacgatttccacttgcctgagggc
aggcatagggaactgggtttcaccttttctttcccagtacaccaaacatcgatatcgtca
ggcaccctcgttaagtggacaaaaggattttgcatcaatggcacggttggggaagatgtg
gtggctgaattgagcagtgctatggagaggcaggggcttgatatgaaagttacagctttg
gttaatgatactgtgggcacgttggctggtgggatatatgctgataatgatgtcgtcgct
gctgtaatattgggcactgggacaaatgcagcgtatgttgagcatgtagatgcaattcca
aaatggaagggaccactacctagatcaggaaacatggtcatcaacatggaatgggggaac
tttaagtcagacaagcttccccgttctgactacgatattgccttggattttgaaagtttg
aaccccggcgagcagatgtatgagaagatgatttcgggcatgtatcttggagaggttgtg
cgaaggatcttgcttaggctggctcatgatgcttccttatttggtgatgttgttccatca
aaattggagaaactatttgtactgaggacgccggatatgtcagccatgcatcatgacacc
tcacatgatctcaagcaccttggtgctaagctgaaggatatcctgggggttgccgatact
tcgctggaagcaagatacataacccttcacgtctgcgacaaggtcgcggagagaggcgcg
cgcctggctgctgccggcatatacggcatcgtgaagaagctgggcagggacagagcgccg
actgacggcagtccgaagcaaaggaccgtcgtcgccatagatggaggcctctacgagcac
tacaagaagttcagctcccgcgtcgaagcgacggtcgcggagctgctcggtgaggcggca
gcctcgtcggtcgtcgtcaagatggccaacgacggctccggcatcggtgccgcccttctc
gcggcctcacattcccagtacaatgtcgtcgagtag

DBGET integrated database retrieval system