KEGG   Aegilops tauschii (wheat D): F775_15372Help
Entry
F775_15372        CDS       T04345                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    F775_15372
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    F775_15372
Enzymes [BR:ats01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     F775_15372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1017 aa AA seqDB search
MDGELGYVDGDEEQEEEDEEEPARRRKKKKRTARSAEPRIKWAPKEEECLAEAWKVVCVD
LTTGANQSIDTIFPTQRACQRIKCKKGKVEECLRVSAEYQRDAGDRAAKLGELGALFTSL
DVGDAIMVSSSLSHMLNLANLAEEIQMVYQKKMETSRRGGFADEALAPTESDIDETFQRM
VGGLGKTPQEVFDALRSQTIDLVFTAHPTQSIRRSLLEKHASIRTCLTQLCVEGVSENEK
QEIDEALQREILAAFRTDEIRRTPPTPQDEMRAGMSYFHDTIWNGVPKFLRRVDTALKNI
GIDERLPYDVPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANMYFSKMGSLMFEV
PFLNLYDAKSMPVLYTVLLSMWRCNDELRARADELHRLSSRKYAKYYIEFWKQISPREPY
RIILGDVRDKLYNTCERAREILSNGESSIPEEDTYTRVEEFLEPLELCYRSLCDCGDKLI
ADGSLLDFMRQVSTFGLCLLKLDIRQESDRHIDAVDAITTHLGIGSYRDWPEEQRQEWLV
NELRGNRPLFGPDLPQSDEVADVLGTFRVISELPADSFGAYVISMATAPSDVLAVELLQR
ECGVKKPMRVVPLFEKLADLQQARATMELLFSIDWYKERINGKQEIMIGYSDSGKDAGRL
SAAWYLYKAQEEIVDVAEQHGVKLTIFHGRGGPVGRGGGPSHLAILSQPPNTVNGSLRGT
VQGEVIEKSFGEDNLCFRTLQRVTAATLEHGRNPPVSPKPEWRALLDDMATVATEEYRSI
VFQEPRFGEYFRSATPETEYGRMNIGSRPSKRKPGGGIESLRAIPWIFAWTQTRFHLPVW
LGFGAAFRHAMDKPGGLATLREMYDEWPFFRVTIDLLEMVFAKGDPGIAALYDKLLVPQD
LWPFGEQLRANYAETQSLLLKVAGHEDLLESDPYLRQRLLLRDSYITALNVCQAYTLKRI
RDGEFRPATRPPLSKEFIDETAESLMELNPSSEYDPGLEDTLILTMKGIAAGMQNTG
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgagctcggctacgtcgacggcgacgaggagcaggaggaagaggacgaggag
gagccggcgaggaggcgcaagaagaagaagcggacggccaggtcagccgagccgcgcatc
aagtgggcgcccaaggaggaggaatgcctcgccgaggcatggaaagtcgtctgcgtcgac
ctgaccaccggcgcgaaccagagcatcgacacgatctttccaacacaacgtgcttgccaa
aggataaaatgtaaaaaaggaaaggtcgaggagtgcctgcgggtgtccgccgagtaccag
cgcgacgcgggcgaccgggcggcgaagcttggcgagctgggggcgctgttcacgagcctg
gacgtgggcgacgccatcatggtgtccagctccctgtcgcacatgctcaacctggccaac
ctcgcggaggagatccagatggtgtaccagaagaagatggagacgagccggcgcggcggc
ttcgccgacgaggccctggcgcccaccgagtcggacatcgacgagaccttccagcggatg
gtgggcgggctgggcaagacgccccaggaggtgttcgacgcgctcaggtcccagaccatc
gacctcgtcttcaccgcgcaccccacccagtccatccggcgctcgctcctcgagaagcac
gccagcatccggacgtgcctgacgcagctgtgcgtggagggcgtgtccgagaacgagaag
caggagatcgacgaggcactgcagagggagatcctggcggcgttcaggacggacgagatc
cggcggacgccgccgacgccgcaggacgagatgcgggcggggatgagctacttccacgac
accatctggaacggcgtgcccaagttcctccgtcgcgtcgacacggcgctcaagaacatc
ggcatcgacgagcgcctcccctacgacgtcccgctcatccagttctcctcctggatgggc
ggcgaccgcgacggcaaccccagggtcacccccgaggtcaccagggacgtctgcctgctc
gccaggatgatggccgccaacatgtacttctccaagatgggcagcctcatgttcgaggtg
ccattcctcaatctctatgatgccaagtcgatgccggttctgtacactgttctgctttct
atgtggcgttgtaacgacgagctccgggcccgggccgacgagctgcaccggctgtcctcc
cggaagtacgccaagtactacatcgagttttggaagcagatttctccgcgtgagccctac
cgcatcatcctcggcgatgtcagggacaagctgtacaacacctgcgagcgcgctcgagag
atcctgtccaatggagaatcgagcatcccagaagaagatacctacacgagggtcgaggag
ttcttggagcctctggagctgtgctaccgatcgctgtgcgactgcggggacaagctgatc
gccgacggcagcctgctggacttcatgcgccaggtctccaccttcggcctctgcctcctc
aagctggacatccggcaggagtcggaccgccacatcgacgccgtcgacgccatcaccacg
cacctcggcatcggctcctaccgggactggcccgaggagcagcgccaggagtggctcgtc
aacgagctccgcggcaaccgcccgctcttcggcccggatctgccacagtccgacgaggtc
gcggacgtgctcggcaccttccgggtcatctccgagctccccgccgacagcttcggggcc
tacgtcatctccatggccaccgcgccgtccgacgtgctcgccgtcgagctgctgcagcgt
gagtgcggcgtcaagaagcccatgagagtcgtgccgctgttcgagaagctcgcggacctt
cagcaggcgcgcgccaccatggagctcctcttctccatcgactggtacaaggagaggatc
aatggcaagcaggagatcatgatcgggtactcggactcgggcaaggacgccggccggctg
tcggcggcgtggtatctctacaaggcccaggaggagatcgtggacgtggcggagcagcac
ggcgtgaagctcaccatcttccacggccggggcggccccgtggggcgcggtggcgggccg
agccacctcgccatcctgtcgcagccgcccaacaccgtcaacggctcgctccgggggacc
gtccagggcgaggtgatcgagaagtcgttcggggaggataacctctgtttccgcacgctg
cagagggtcacggcggcgacgctggagcacggcaggaacccgcccgtgtccccgaagccg
gagtggcgtgcgctgctggacgacatggccacggtggccaccgaggagtaccggtccatc
gtgttccaggagccgcgcttcggggagtacttccggtcggcgacgccggagacggagtac
gggcggatgaacatcggcagccggccatcgaagcggaagccgggcggcggcatcgagtcg
ctgcgcgccatcccgtggatcttcgcgtggacgcagacgcggttccacctccccgtgtgg
ctgggcttcggcgccgcgttccggcacgccatggacaagcccggcggcctcgccacgctc
cgtgagatgtacgacgagtggcccttcttccgcgtcaccatcgacctcctcgagatggtc
ttcgccaagggcgaccccggcatcgccgcgctctacgacaagctcctcgtcccccaagac
ctctggcccttcggcgagcagctcagagccaactacgccgagacacagagcctcctcctg
aaggttgctgggcacgaagacctgctggagagcgacccgtacctgaggcagcggctgttg
ctgcgggactcgtacatcacggcgctcaacgtgtgccaggcgtacactctgaagaggatc
agggacggcgagttcaggccggcgacgcgaccgccgctgtccaaggagttcatcgacgag
acggcagagagcttgatggagctcaaccccagcagcgagtacgaccccgggctggaggac
acgctcatcctcaccatgaagggaatcgccgcgggcatgcagaacacgggctga

DBGET integrated database retrieval system