KEGG   Aegilops tauschii (wheat D): F775_29085Help
Entry
F775_29085        CDS       T04345                                 

Definition
(GenBank) Glutamate decarboxylase 1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    F775_29085
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F775_29085
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F775_29085
   00430 Taurine and hypotaurine metabolism
    F775_29085
Enzymes [BR:ats01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     F775_29085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
MVISHSSSGPGESAYNTFSSRYAGVELPRYRMPENSIPKETAYQMITDELMLDGNPRLDL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPINEDEKAIG
VSTVGSSEAIMLAGLAFKRKWANKRKEEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLTEGYYVMDPLKAVEMVDENTICVAAILGSTLTGEYEDVKLLNDLLVEKNKETGWNVP
IHVDAASGGFIAPFLHPELEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKDDLPEEL
IFHINYLGTDQPTFTLNFSKGASQIIAQYYQLIRLGFEGYKHIMENCQANAAVLREGMEA
TGRFSIVSKEDGVPLVAASLKDSTKFSVFDVSENLRKFGWIVPAYTMAPDAEHVAVLRVV
IREDFSRSLAQRLLADINKVLHELDAHAAHAIKVTAPTATQNGNGVDGDDTVTHKSVLDT
EKRFVAACMSLVKKNKKTGVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgatctcgcactcgagctccggccccggcgagtccgcgtacaacaccttctcgtcg
cgctacgccggcgtggagctcccgaggtaccggatgccggagaactcgatccccaaggag
acggcgtaccagatgatcacggacgagctgatgctggacggcaacccgcggctggacctg
gcgtccttcgtcaccacgtggatggagcccgagtgcgacaagctcatcatggactccatc
aacaagaactacgtcgacatggacgagtaccctgtcaccaccgagctccagaaccgttgt
gtcaatatgattgctcacttattcaatgcaccgataaacgaggatgagaaagctattgga
gtctcaacagttggatcctcggaagcaataatgcttgcaggccttgcgttcaagaggaag
tgggcaaataaaaggaaggaggaggggaagccatatgacaaacccaacattgttactggt
gcaaatgttcaggtttgctgggagaaatttgctagatattttgaagtagaattgaaggag
gtcaagttaactgaaggatactatgtaatggatcctttgaaggccgttgagatggtggat
gagaacactatatgtgttgcagccatcttgggatcaactctcactggagagtacgaagat
gtcaaactattgaatgaccttcttgtggaaaagaacaaggaaacggggtggaatgtgcca
atccatgttgatgctgctagtggaggatttatcgctcctttcctacatcctgagcttgag
tgggacttcaggctaccattggtgaagagcataaatgttagtggacacaagtatggcctt
gtctaccctggtgttggatgggtcgtttggcggagcaaagacgatttgcccgaagaactc
attttccatataaactatctagggacagatcagcccacatttacactgaacttctccaaa
ggtgcaagccagataattgcacaatactatcaactgatacgccttggcttcgagggatac
aagcacatcatggagaattgccaggcgaatgcagccgtgctgagggagggcatggaggcc
actggccgattcagcatcgtgtccaaggaggacggcgtgccattagtcgccgcctcgctc
aaggacagcaccaaattcagcgtgttcgacgtctctgagaacctgcggaaattcggctgg
atcgtgccagcctacacgatggctccggatgcggagcacgtcgccgtcctccgtgtggtc
atcagggaggacttcagccggagcctcgcccagcggctcctcgcggacatcaacaaggtc
ctgcacgagctggacgcgcatgcagcccatgccattaaggtcactgctcctaccgcaaca
caaaacggcaatggcgtcgacggcgacgacaccgtgacacataagagcgtcctggacacc
gagaagaggttcgttgcggcctgcatgtccctggtaaagaaaaataaaaagactggagtg
tgctaa

DBGET integrated database retrieval system