KEGG   Aureimonas sp. AU20: M673_00070Help
Entry
M673_00070        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
aua  Aureimonas sp. AU20
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aua00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    M673_00070
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    M673_00070
Enzymes [BR:aua01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     M673_00070
Peptidoglycan biosynthesis and degradation proteins [BR:aua01011]
 Precursor biosynthesis
  Racemase
   M673_00070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
12934..14082
Genome map
AA seq 382 aa AA seqDB search
MSVVSSRPTPDLPVSAAGAASAGAVLTVDLAALRANYRRLRLEAGGAAVGGVVKADAYGL
GAERIAPVLWEEGCRSFFVAHLSEALLLRPVLPHDAEIVVLNGLAPGDEARCAAAGIVPV
VNSASQLAAWSALGRALGKRLPAALQLDSGMARLGLSPDEVLAIEAEPERLGGVETVLVM
SHLACADEPAHPANPAQLAAFRALAARLPAARRSLANSAGLFLGSDYRFDLCRPGIALYG
GKPTEGPLNPMRAVARLDARVIQLRDVPAGTGVGYGWSLVAPGAMRLATIGIGYADGWPR
SLSNRLGAFLDGARLAAAGRVSMDSVILDAGGAPLSPGDLVELIGPHQTLEEVAAAAGTI
PYEILTALGQRFERRYVEGRLA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtggtttcgtcccgtcccactcccgatctgcctgtttccgcggcaggggccgcc
agcgccggcgcggtgctgaccgtggatctcgccgccctgcgggccaattatcgccggctc
cggctggaggccggcggcgcggcggtgggcggcgtcgtcaaggcggacgcctacgggctc
ggggcggagcgcatcgctccggtgctctgggaagaagggtgccgctccttcttcgtcgcc
catctcagcgaggcgctgctgctgcgccccgtcctgccccatgatgcggaaatcgtcgtc
ctgaacgggctagcgccgggcgacgaggcgcgctgcgcggcggccggcatcgtgcccgtg
gtgaactcggccagccagctcgccgcctggagcgcactcggccgtgccctcggcaagcgt
cttcccgccgcgcttcagctcgacagcggcatggcgcggctcggcctttcaccggacgag
gtgctcgccatcgaggccgagccggagcggctggggggcgtcgagaccgtgctggtcatg
agccatctcgcctgcgccgacgagcccgcacacccggccaaccccgcgcagctcgccgcc
tttcgcgcccttgccgcccggctgccggcggcgcggcgctcgctcgccaattccgccggc
ctgtttctcggctccgactaccgcttcgacctctgccggcccggcatcgcgctctatggg
ggcaagccgacggagggcccgctcaacccgatgcgcgccgtggcgcggctcgacgcgcgc
gtcatccagctgcgcgacgtgccggccggcaccggcgtcggctacggctggagcctcgtc
gcgcccggcgccatgcggctggcgacgatcggcatcggctatgccgacggctggccgcgc
agcctgagcaaccggctcggcgcctttctggacggggcgaggctcgcggcggccggccgc
gtttccatggattcggtgatcctcgacgcgggcggggcgccgctttcgcccggcgatctc
gtggaactgatcggcccgcatcaaacgttggaagaggtggcggcggcggccggcacgatc
ccctatgaaatcctcaccgcgctcggccaacgcttcgagcggcgttatgtcgaaggacga
ctggcatga

DBGET integrated database retrieval system