KEGG   Trichormus variabilis: Ava_0390Help
Entry
Ava_0390          CDS       T00277                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
ava  Trichormus variabilis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ava_0390
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Ava_0390
Enzymes [BR:ava01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Ava_0390
Peptidoglycan biosynthesis and degradation proteins [BR:ava01011]
 Precursor biosynthesis
  Racemase
   Ava_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
504016..505203
Genome map
AA seq 395 aa AA seqDB search
MLSRQQASSMAAHQQCDTYAWFSQRAWVEIDLEALSHNVQQLKQFLSPRTQLMAVVKADA
YGHGAVTVAQTALQAGASCLGVATVPEGIQLREAGMQAPILILGATHTPEQIQAIAQWQL
QPTIGSPKQALIFSNTLETIQHDSPVPVHIKLDTGMSRLGTNWQQAGEFVQLVERLPHLN
IASVYSHLATADSPDPGIMEEQYRRFEEAIAQIKALSIKIPCLHLANSAATLADPRLHYD
MVRVGLAVYGLYPAPHLQKKISLKPVIQVQARVTHVKTIAAGTGVSYGHQFIAPHEMRLA
VVGIGYADGIPRNLSNKMQVLIRGQRVPQIGAITMDQLMIDVSALPDLQEGEIVTLLGKQ
GKEKITADDWAEELNTISWEILCGFKHRLPRVGVM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtcgccaacaagcctcaagtatggctgctcatcaacagtgtgatacctatgct
tggttttcacaacgcgcttgggtggaaattgacctagaggcgttgtcgcacaatgtccag
caactgaagcagtttttatcaccgcgtactcagttaatggcggtagtcaaagcagatgct
tatggtcatggtgctgtaacggtggcgcagacagcattacaagcaggtgctagttgtttg
ggtgtcgccactgttccggagggtattcaactgcgagaggcgggtatgcaagcgcccatt
ttgattttaggggctacccatacaccagaacaaattcaggcgatcgctcaatggcaacta
caaccaactattggtagtcctaaacaagctttaatattttccaataccttggagactatc
cagcatgattctcctgtacccgtacatattaagttagatacagggatgtctagacttggg
actaactggcaacaagcaggggaatttgtacagttagtagagcgtttaccccatttgaat
attgctagcgtttactcccacctagcaacagcagatagcccagatccagggattatggaa
gaacagtatagaagatttgaggaggcgatcgctcaaatcaaagctttgagtattaaaatt
ccctgcctgcatttagcaaactcggctgcaaccttggcagatccaagattacactacgat
atggtacgggtaggtttagctgtgtatggactctatccagcccctcatttacagaagaaa
atcagcctaaaaccagtcatccaagttcaggcgcgagttacccacgtcaaaacaattgct
gcgggtactggtgtaagttacggacatcaatttattgccccccatgaaatgcgccttgct
gttgtcggtattggttacgctgatggaataccgcgtaatttatccaacaaaatgcaggtt
ttaattcgtggtcagcgagtaccacaaatcggtgctatcacgatggatcagttgatgata
gatgttagtgctttaccagacctacaagaaggggaaattgtcaccttacttgggaaacaa
ggaaaagaaaaaatcaccgccgatgattgggcagaagagttaaatactatttcctgggaa
attctctgtggatttaaacatcgcctacctcgtgtaggagtgatgtaa

DBGET integrated database retrieval system