KEGG   Azotobacter vinelandii CA6: AvCA6_25650Help
Entry
AvCA6_25650       CDS       T02634                                 

Definition
(GenBank) peptide synthase
Organism
avd  Azotobacter vinelandii CA6
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2608602..2621558)
Genome map
AA seq 4318 aa AA seqDB search
MTDTFERPVSMADALMRRAAAQPERLALRFLGGDGEEVLSYRQLDRQARIIAAALAERGE
PGERAVLLFPSGPDYVAAFFACLYAGVIAVPAYPPESSQEQHLRRLISIIADAQPRLILT
TSGVAGSLAALGEGRGDALPELLAVDALDPALADGWRAPAVPAEAIAFLQYTSGSTATPK
GVQVSHANLEANEWLIRQGYRIGDDDTIVSWLPLYHDMGLIGGLLQGIYSGVPVVLMSPQ
HFLERPVRWLEAIGRYRGTISGGPDFAYRLCHERIAEGNLAGLDLSGWRVAFSGSEPIRQ
DSLAAFAERFAPCGFRPDAYLASYGLAEATLFVSGGRPGQGISALRLDAAALAADRAEPG
EGPVLMSCGWEQPGHPLLIVDPRSGEALGDGLVGEIWSSGPSVAQGYWRNPQATAQVFVE
RDGRTWLRTGDLGFRQRGELFVTGRLKDMLIVRGQNLYPQDIERTVEECVAEVRRGRVAA
FAVEHEGREALGVAAEIGRRTAQQVAADELLGRIRQAVAEAHHEAPVLVLLLEPGALPKT
SSGKLQRSACRQRHEAGELVPIASFREGRGAEPAADATPPGERLAALWRTLLKVERLDPD
AHFFALGGNSIQAIQMIAELRDELGVDLELRSLYEAPTLRAFGAELERLLAEGGASATGI
PRLPREGALRQSAAQNRLWFLWQLEPHSVAYNIPGGLRLRGELDEQALRHSFATLVERHE
SLRTTFYEEDGIGFQCAGTASDWTLLRDDLSALPEAQREERAWTIREEEARFHFDLEHGP
LLRVRLVSLDEQEHLLLVTLHHIVADGWSLGLLLDEFARLYAARIQGQTASLAPLPIRYA
DYAAWQADDGERLAAQLDYWRAELADEHQPLALPLDRPRGGRESSAERFGLRLDKALGER
LQAIARARGTTLFAVLLAAFQTLLHRYTGQSDIRLGVPNANRPRRELQGLVGFFINTQVL
RGRLDSRQTFAALLEAARRTVEGAQANQDLPYERLVEALGGEPPFEVMFNHQQRDLEALR
RLPGLLAEELPWHSREAKFDLQLHSEEDRQGRIRLSFDYACELFERASVERLAGHFVRLL
EQIGENPERAIGDFELLGVDERQRLHDWARGPAEPAGVLLPELLTAQARATPQAIALVSG
EATLDYTDLERRANRLAHRLRELGVGPEAKVGLLAGRGVELMVALLAVVKAGGAYVPMDA
DYPRERLAWMIGDSGLSLLLGHRRVLDALEAPAGLATLPLEELDAEGYPDTPPALALDAG
NLAYVIYTSGSTGQPKGVGVSHGALSERLHWMRREYALDASDVLLQKAPLGFDVSVWECF
LPLIAGSRLVLAADGEHRDPRRLVELARAHGATCLHFVPPLLQLFVEEPALGDCRRLRLL
FSGGEALSAELCRRVRERLPQVALHNRYGPTETAINVTHWRCAEEGARVPIGRPLANVVC
ELRDAELELAPGGAVAELLLGGSGLARGYLGRPALTAERFVPGEDGARLYRSGDLARWRD
DGALEFLGRADEQVKVRGFRIEPEEIRAHLLSQPAVRQAVVLVREGAAGARLVAYLTSDG
AQDDPALAERLKRALAASLPEYMVPAQFVRLDALPLTPTGKLDRKALPEPDWRAGEYVAP
RDERERRLAAIWQEVLGLPRVGLDDDFFALGGHSLLATRIVSRVRQAFDLDLPLRSLFEA
SRLGEFAAEVARLQAEGARDGWGAIERADRGQRIPLSHSQQRMWFLWQLDPQSPAYNVGG
MARLSGPLDAQRFEMALQALIRRHETLRTTFPSDDGKPWQQVAERSDLCMQRLDLSSLPA
DQRRARLQELADEQAHQPFDLERGPLLRVCLVKAGEHKHYLVVTLHHIVTEGWAMDVFAR
ELGALYEAFLDGRESPLEALPVQYLDYSQWQRRWLEGGERQRQLDYWKRQLGDEHPLLEL
PADRPRPPVQSHRGELFRFDLEPALAGRVRAWNAAHGLTMFMTATAALALLLYRYSGQGD
LRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGRMSVDELLEQVRDTVIEGQAHQDLPF
DELVEALQPPRSAAHHPLFQVMCNVQRWEFQQTRQLAGMTVEYLVNDARATKFDLYLEVT
DLDQRLGCCLTYSSDLFDEPRIVRMAGHWTRLLEAMVELPSRRLAELPMLAEAEATRLAE
APGDYPLDACLHELFETQAARTPEAPALTCAGRTLSYAELDVRANRLARVLRERGGGPEV
PVGLALERSAEMVVGILAILKAGGAYVPLDPEYPLERLRYLIEDSGIALLLGHAVLFEAL
GELPAGVARWCLEDDLAALDGQSGAPLPRLAGPDNLAYLIYTSGSTGQPKGVAVCHGEIA
MHCRAVIERFGMAASDCELHFYSINFDAATERLFAPLLCGARLVLRGQGQWDAESICQLI
REQSVSILGFTPSYGSQLAQWLISRDERLPVRLCITGGEALSGEHLQRIRAAFAPQAFFN
AYGPTETVVMPLACRAPETLEEGAASVPIGSLVGARRGAILDADLAPLPQGAAGELYLGG
KGLARGYHRRPALTAERFVPDADGARLYRSGDRVRLRDDGQVEYLGRIDQQVKVRGFRIE
LGEIEARLREHPAVTDTAVLALDTSSGKQLAGYVATATAGLDEAARAALREALKAHLRAQ
LPDYMVPAHLSLLEKLPLTPNGKLDRRALPAPDPEQDRQAYQAPRSELERQLATIWTEAL
NVGRIGLGDNFFELGGDSILSIQVVSRARQAGIHFTPRDLFQHQTVQALATVARSVATVA
SEQGPLSGATPLTPIQHWFFEQHLAKPQHWNQSLLLEPSGRLDADCLEKALHYLRNHHDA
LRLAFRRIDGHWRAEYRAVGEGGGELLWRVRPAGPEERRALFAEAQRSLDLAHGPLLRAV
LAEDASGRQTLLLAIHHLAVDGVSWRVLLEDLQSLYRQFEAGRSPALPARTSSLRDWATR
LEAYAASESLREELVWWRTHLAGTDGELPCDRAGTDDRYRDARSLSLRLDTTRTRQLLQQ
APAAYRSRVDELLLTALARVLCRWSGRDAALVQLEGHGREALFDDIDLTRTLGWFTSAYP
VRLQPAGELADAIKAVKEQLRGVPHKGLGHGVLRHLADADTRAAMAALPQARITFNYLGQ
FDQSFAHDALFRPLDEPAGPAHAEDAPLPNRLSIDAQVYGGELRLRWTYGAGRYDEGSVR
ALAEELLAELQRLIEHCLEEESGGPTPSDFPLAQLTQAQLDALPVPAAAIEDIYPLTPMQ
EGLLLHTLLEPGTGIYYMQDRYRIDSELDLQRFEQAWQAVVARHEALRASFTWNSGETML
QIVHKPGAARIDYQDWSALDADGHEERLQALHKRERETGFDLLREPPFHLRLIRLGEARY
WFMMSNHHILIDAWCRGLLMGDFMEIYAALGEGREPRLPSAPRYRDYIAWLQRQDFEAAR
NWWRDNLRGFERPTAIPGDRPLLREHTGGMQVGDCLTRLEAADGARLRELAQRHQLTVNT
FAQAAWALVLHRYSGERDLTFGVTVAGRPVSMPALQGTVGLFINSIPLRLRLPEAGERRA
VRDWLRELLERNLELREYEYLSLVDIQECSELPKGQPLFDSLFVFENAPVDSAVLDRAQG
LKARSESGRTHTNFPLTVVCYPGDDLGLHLSYDRRYFEAATIERLLGDFKRLLLALADGI
LGDLSDLPLLDHGEREFLTEGCNRSERDYPLEQGYARLFEARVAAHPERIVARCQDAQWN
YAGLNARANRLGHALRAAGVGVDQPVALLAERGLDLLGMMIGAFKAGAGYLPLDPGHPAQ
RLTRILELGRVPLLVCSAACRAQAVELLEALAGQGRPRLLVWDEVQAGDWPTANPGVYSG
PDSLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLGLDEADAIAQTASQSFDISVWQ
FLAAPLFGGRVEIVPNAIAHDPGALLALARERGVTVLESVPSLIQGMLAEERDGLGALRW
LLPTGEAMPPELARQWLQRYPQVGLVNAYGPAECSDDVALFRVDMEATAGSYLPIGSPTD
NNRLYLLDEALELVPAGATGELCIAGTGVGRGYVGDPLRTALAFLPNPFAREPGERLYRS
GDLARRRVDGLLEYVGRIDHQVKIRGFRIELGEIEAHLHEQAEVREAAVAVQEGPNGKYL
VGYLVPADMELAEVSPATAPLLHGELFERVKQRLRAELPDYMVPAHWLLLEGLPRNTNGK
LDRKALPELEIGQSRGQAYLAPRNDLERTLATIWAELLKVERVGVHDNFFELGGHSLLAT
QIASRVQKALQRNVPLRAMFECSTVGELAAYIESLEGSALTEQKASRLDDLMSRLEAL
NT seq 12957 nt NT seq  +upstreamnt  +downstreamnt
atgacggataccttcgaacgccccgtttccatggccgatgccctgatgcggcgcgccgcc
gcccagccggagcggctggcgttgcgctttctcggcggcgacggggaggaggtgttgagc
taccggcaactggaccgccaggcgcgcatcatcgcggcggcgctggcggagcgcggcgag
ccgggcgagcgcgcggtcctgctgtttcccagcgggccggactacgtcgcggcattcttc
gcctgcctgtacgccggggtgatcgcggtgccggcctatccgccggagagcagccaggaa
cagcacctgcgccgactgatctcgatcatcgccgacgcccagccacggctgatcctcacc
acctccggggtggccggttcgctggccgccctgggggaaggccgcggcgacgcgctgccc
gaactgctggcggtggacgcgctggacccggccctggccgacggctggcgggcgccggcg
gtgccggccgaagccatcgccttccttcagtacacctccggctccaccgcgacccccaag
ggcgtgcaggtcagccacgccaacctggaggccaacgaatggctgatccgccagggctac
cggatcggcgacgacgacactatcgtcagttggctgccgctgtaccacgacatggggctg
atcggcggactgctgcagggcatctatagcggcgtgccggtggtgctgatgtcgccgcag
catttcctcgaacggccggtgcgctggctggaggcgatcggccgctaccggggcaccatc
agcggcggtccggacttcgcctatcggttgtgccacgagcgtatcgccgagggcaacctg
gccggcctggacctgtccggctggcgggtggccttctccggttccgagccgatccgccag
gacagcctggcggcgttcgccgaacgcttcgcgccctgcggcttccgtcccgatgcctat
ctggccagctacggcctggccgaggcgaccctgttcgtcagcggcggccggccggggcag
ggcatctccgccctgcggctcgacgccgccgcgctggcggccgaccgcgccgagcccggc
gaaggtccggtactgatgagctgcggctgggaacaacccggccatccgctgctgatcgtc
gacccgcgcagcggcgaggcgctgggcgacgggctggtcggcgagatctggtcgagcgga
ccgagcgtcgcccagggctactggcgcaatccgcaggcgaccgcacaggttttcgtcgag
cgtgacggtcgcacctggctgcgcaccggcgacctgggattccgccagcggggcgaactg
ttcgtcaccgggcggctcaaggacatgctgatcgtgcgaggccagaacctctatccccag
gacatcgagcgcaccgtggaggagtgcgtcgccgaggtgcggcgcgggcgcgtggcggcc
ttcgcggtggagcacgagggccgcgaggcgctcggcgtggcggcggagatcggccggcgc
accgcccagcaggtggccgccgacgaactgctcgggcgcatccgccaggcggtggccgaa
gcgcaccacgaggcgcccgtactggtgctgctgctggagcccggcgcgctgccgaagacc
tccagcggcaaattgcagcgttccgcctgccggcaacgccacgaggcgggggaactggtg
ccgatcgcttccttccgcgagggacggggcgccgagcctgccgccgacgcgacgccgccc
ggcgaacgcctcgccgcgctctggcggacgctgctcaaggtcgaacggctcgaccccgac
gcgcacttcttcgccctgggcggcaattccatccaggccatccagatgatcgccgagctg
cgcgacgaactgggcgtcgacctggagctgcgcagcctctacgaggccccgaccctgcgg
gcgttcggcgccgagctggagcgcctgctggccgaaggcggcgcgtccgccaccggtatc
ccgcgcctgccgcgcgagggcgccctgcgccagtcggcggcgcagaaccgcctgtggttc
ctctggcaactggagccgcacagcgtcgcctacaacattcccggcggcctgcgcctgcgc
ggcgaactggacgagcaggcgctgcgacacagcttcgcgacgctggtcgagcgccacgaa
tcgctgcgcaccaccttctatgaggaagacggcatcggcttccagtgcgccggaacggcg
tccgactggacgctgctgcgcgacgatctttccgcgctgcccgaagcgcagcgcgaggag
cgggcgtggacgatccgcgaggaagaggcgcgtttccatttcgacctggagcacggcccg
ctgctgcgcgtgcggctggtcagcctggacgaacaggagcacctgttgctggtgaccctg
caccacatcgtcgccgacggctggtcgctgggcctgctgctcgacgaattcgcccggctc
tacgccgcgcggatccaggggcagacggcatccctggcgcccctgccgatccgctacgcc
gactatgcggcctggcaagcggacgatggcgaacgcctcgccgcgcaactggactactgg
cgcgccgaactggccgacgagcaccagcccctggcgctgccgctggaccggccgcgcggc
ggccgggagtcgtccgccgagcgtttcggtctgcgcctggacaaggccctcggcgaacgc
ctgcaggccatcgccagggcgcggggcaccacgctgttcgcggtcctcctggcggccttc
cagaccctgctgcaccgctataccgggcaatccgacatccgcctcggcgtgcccaacgcc
aaccgcccgcgccgcgagttgcagggactggtcggcttcttcatcaatacccaggtgctg
cgcgggcggctggattcgcggcagaccttcgccgcgctgctggaggccgcgcggcgcacg
gtcgagggcgcccaggccaaccaggacctgccgtacgagcggctggtcgaggcgctgggc
ggcgagccgccgttcgaggtgatgttcaaccaccagcagcgcgacctggaagcgctgcgc
cgcctgccggggctgctcgccgaggaactgccctggcacagccgcgaggccaagttcgac
ctgcaactgcacagcgaggaggaccgccaggggcgtatccgcctgtctttcgactacgcc
tgcgaactgttcgagcgcgccagcgtcgagcgtctcgccgggcatttcgtgcgcctgctg
gaacagatcggcgagaaccccgagcgcgccatcggcgacttcgagctgctcggtgtcgac
gagcgccagcgactgcacgactgggcgcgcgggccggccgaaccggccggcgtcctgctg
cccgaattgctgaccgcccaggcacgggcgacgccgcaggccatcgccctggtcagtggc
gaggcgaccctcgactacaccgacctggagcgccgcgccaaccgcctggcgcaccgcctg
cgcgagctgggcgtcggcccggaggcgaaggtcggcctgctggccggacgcggcgtcgaa
ctgatggtggctctgctggcggtggtcaaggccggcggcgcctacgtgccgatggacgcc
gactacccgcgcgaacgcctggcctggatgatcggcgacagcggcctgagcctgctgctg
ggccaccggcgggtgctggacgcgctggaagcgccggccggactggcgacgctgcctctg
gaggagctggacgccgagggctacccggacacgccgcccgccctggcgctggacgccggc
aacctggcctacgtgatctacacctccggctccaccggccagcccaagggcgtcggcgtc
agccatggcgcgctgagcgaacgcctgcactggatgcgccgcgagtacgccctggatgct
tccgacgtgctgctgcagaaggcgccgctcggcttcgacgtgtcggtctgggaatgcttc
ctgccgctgatcgccggcagccgcctggtgctggcggcggatggcgagcaccgcgacccg
cgccggctggtggaactggcacgggcgcacggggcgacctgcctgcacttcgtgccgccg
ctgctgcaactgttcgtcgaggaaccggcgctcggcgactgccgccgcctcaggctgctg
ttctccggcggcgaggcgctctccgccgagctgtgccggcgggtgcgcgaacggctgccg
caggtcgcgctgcacaaccgctacgggccgaccgagacggcgatcaacgtcacccactgg
cgctgcgcggaagagggcgcgcgggtgccgatcggccggccgttggccaacgtggtctgc
gagctgcgcgacgccgaactggaactggcgcccggcggcgcggtggccgaactgctgctc
ggcggcagcggcctggcgcgcggctatctggggcgtccggcgctgaccgccgagcgcttc
gtgccgggcgaggacggcgcgcggctgtaccgcagcggcgacctggcgcgctggcgggac
gacggggcgctggaattcctcggccgcgccgacgagcaggtgaaagtgcgcggtttccgc
atcgaaccggaggaaatccgcgcgcacctgctgtcgcagccggcggtgcgccaggccgtg
gtgctggtgcgcgagggcgccgcgggtgcgcgactggtcgcctacctgaccagcgacggc
gcacaagacgatccggccctggccgaacgcctcaagcgcgccctggccgccagcctgccg
gagtacatggtgccggcgcagttcgtccgcctcgacgcgctgccgctgacgccgaccggc
aagctggatcgcaaggcgctgccggagccggactggcgggcgggcgaatacgtcgctccg
cgcgacgagcgcgaacggcgcctggcggcgatctggcaggaggtgctgggcttgccgcgc
gtcggcctggacgacgacttcttcgccctgggcggccattcgctgctggccacccgcatc
gtctcgcgggtgcgccaggcgttcgacctcgacctgccgctgcgcagcctgttcgaagcc
agccgcctcggcgagttcgccgccgaagtggcccgcctgcaggccgagggcgcgcgcgac
ggctggggcgcgatcgagcgggcggatcgtggccaacgcatcccgctgtcgcattcccag
cagcgcatgtggttcctctggcagctcgacccgcagagcccggcctacaacgtcggcggc
atggcgcggctgagcgggccgctcgatgcgcaacgcttcgagatggccctgcaggcgctg
atccggcgccacgagaccctgcgcaccaccttccccagcgacgacggcaagccctggcag
caggtggccgagcgatccgacctgtgcatgcagcggctggacctgtcctcgctgccggcc
gaccagcgccgggcgcgcctgcaggaactggccgacgagcaggcgcaccagcccttcgac
ctggagcgcgggccgctgctgcgcgtgtgcctggtaaaggccggcgaacacaagcattac
ctggtggtgaccctgcaccacatcgtcaccgaaggctgggcgatggacgtgttcgcccgc
gaactgggggcgctctacgaggcgttcctcgacgggcgcgaatcgcctctggaagccttg
ccggtgcagtatctcgactacagccagtggcagcgccgctggctggagggcggcgagcgc
cagcgccagctcgactactggaaacggcagttgggcgacgagcatccgctgctcgagctg
cccgccgaccgtccgcgtccgccggtgcagagccatcgcggcgagctgttccgcttcgac
ctcgagccggcgctggccgggcgggtgcgcgcctggaacgcggcccacggcctgaccatg
ttcatgaccgccaccgccgccctggcgctgctgctgtaccgctacagcggacagggcgac
ctgcgcatcggcgcgccggtggccaatcgcatccgcccggaaagcgagggactgatcggt
gccttcctcaacacccaggtgctgcgctgccggctggacgggcggatgagcgtcgacgaa
ctgctcgaacaggtacgcgacacggtgatcgagggccaggcccaccaggacctgccgttc
gacgaactggtggaagccctgcaaccgccgcgcagcgccgcccatcacccgctgttccag
gtgatgtgcaacgtgcagcgctgggagttccagcagacccggcaactggccgggatgacc
gtcgaatacctggtcaacgacgcgcgggcgaccaagttcgacctctacctggaggtgacc
gatctcgaccagcgcctgggctgctgcctgacctacagcagcgacctgttcgacgaaccg
cgcatcgtgcgcatggccgggcactggacgcgcctgctggaggcgatggtcgagctgccg
tcgcggcgcctcgccgaactgccgatgctggccgaggccgaagccacccggctggccgaa
gcgcccggcgactacccgctggacgcctgcctgcacgaactgttcgaaacccaggcggcg
cggacgcccgaagcgccggcgctgacctgcgccgggcggaccctgagctacgccgagctg
gatgtccgggccaaccgcctggcccgcgtgctgcgcgagcgcggcggcggcccggaagta
ccggtcggcctggccctggaacgctcggcggagatggtcgtcggcatcctggcgatcctc
aaggccggcggcgcctacgtgccgctcgacccggaatacccgctggagcgcctgcgctac
ctgatcgaggacagcggcatcgccctgctgctcggtcacgccgtgttgttcgaggcgctc
ggcgagctgccggccggcgtcgcgcgctggtgcctggaggacgacctcgccgccctggac
ggccagtccggcgcaccgctgccgaggctcgccggcccggacaacctcgcctacctgatc
tacacctccggctccaccggccagcccaagggcgtggcggtgtgccacggcgagatcgcc
atgcactgccgggcggtgatcgagcgtttcggcatggcggcctccgactgcgagctgcac
ttctattcgatcaacttcgacgccgccaccgaacggctgttcgcgccgctgctgtgcggc
gcgcggctggtactgcgtgggcagggacaatgggatgcggaatcgatctgccagttgatc
cgcgagcagagcgtgagcatcctcggtttcacccccagctacggcagccagttggcgcaa
tggctgatcagtcgcgacgagcgcctgccggtgcggctgtgcatcaccggcggcgaagcg
ctgagcggcgagcacctgcagcggattcgcgcggccttcgcgccgcaagccttcttcaat
gcctacgggccgaccgagacggtggtcatgccgctggcctgccgggcgccggaaaccctg
gaggagggcgccgccagcgtgccgatcggcagcctggtgggcgcccgccgcggcgccatc
ctcgatgccgacctggcgccgctgccgcagggcgccgccggcgagctgtacctcggcggc
aagggcctggcgcgcggctaccaccggcgcccggcgctgaccgccgaacgcttcgtgccg
gatgcggacggcgcgcgcctgtaccgcagcggtgaccgggtacgcctgcgcgacgacggc
caggtggagtatctcgggcgcatcgaccagcaggtcaaggtgcgcggcttccgtatcgaa
ctgggcgagatcgaggcgcgcctgcgcgagcatccggccgtgaccgacacggcggtgctg
gccctggacacatcgtccggcaagcaactggccggctacgtggcgaccgccacggcaggg
ctcgacgaagcggcgcgcgcggcactgcgcgaagcgctcaaggcccacctgcgcgcgcaa
ctgcccgactacatggtgccggcgcacctgtcgctgctcgaaaaactgccgctgaccccc
aacggcaagctcgaccgccgcgccctgccggcgcccgaccctgagcaggaccgccaggcc
taccaggcgccgcgcagcgagctggaacggcaactggcgacgatctggaccgaagcgctg
aacgtcggccgcatcggtctcggcgacaacttcttcgaactgggcggcgactcgatcctg
tcgatccaggtggtcagccgcgcccgccaggcgggcatccacttcaccccgcgcgatctg
ttccagcaccagacggtgcaggccctcgccacggtggcccggagcgtcgccacggtagcc
agcgaacaagggccgctgagcggcgccacgccgctgacgccgatccagcactggttcttc
gaacagcatctcgccaagccacaacactggaaccagagcctgctgctggagccgagcggc
cggctggatgccgactgcctggaaaaggccctgcattacctgcgcaaccaccacgacgcc
ctgcgcctggccttccgccggatcgacggccactggcgggccgaataccgcgcggtgggc
gagggcggcggggaactgctgtggcgggtccggccggccggcccggaagaacgccgggcg
ctgttcgccgaagcccagcgcagcctcgacctggcgcacggcccgctgctgcgcgcggtg
ctggcggaggacgccagcggccggcagacgctgctgctggcgatccatcacctggcggtg
gacggggtgtcctggcgggtgttgctggaagacctgcagagcctctaccggcagttcgaa
gccggccggtctccggcattgccggcgcggaccagctcgttgcgcgactgggccacacga
ctggaagcctacgccgccagcgaatcgctgcgcgaggaactggtctggtggcggacgcac
ctggccgggacggacggcgagctgccctgcgaccgggccggcaccgacgaccgctaccgg
gacgcccgcagcctgagcctgcgcctcgacaccacgcgcacccggcagttgctgcagcag
gcgccggcggcctaccgcagccgggtggacgagctgctgctcaccgccctggcccgcgtg
ctgtgccgctggagcgggcgcgacgcggcgctggtgcaactggaggggcacggccgcgag
gcgctgttcgacgacatcgacctgacccgcacgctgggctggttcaccagcgcctacccg
gtgcgcctgcaacccgccggggaattggcggatgccatcaaggcggtcaaggaacaactg
cgcggcgtgccgcacaagggcctcggccacggcgtgctgcgccatctcgccgacgccgac
acgcgcgcggcgatggccgcgctgccgcaggcgcggatcaccttcaactacctcggccag
ttcgaccagagcttcgcgcatgacgcgctgttccggccgcttgacgaaccggccggcccg
gcccacgccgaggacgcgccgctgcccaaccggctgtcgatcgacgcccaggtctacggc
ggcgagctgcgcctgcgctggacctacggcgccggccgctacgacgaaggcagcgtgcgg
gcgctggccgaggagctgctggcggaactgcagcggctgatcgagcactgcctggaagag
gagagcggcggcccgacgccctcggatttccccttggcacagctcacccaggcccagctc
gacgcgctgccggtgccggcggcggcgatcgaggacatctacccgctgaccccgatgcag
gagggcctgctgctgcacaccctgctggagccgggcaccggcatctactacatgcaggac
cgctaccggatcgacagcgaactcgacctgcagcgcttcgagcaggcctggcaggcggtg
gtggcgcgccatgaggcgctgcgcgcctccttcacctggaacagcggcgagaccatgctg
cagatcgtccacaagccgggcgccgcacgcatcgactaccaggactggagcgcgctggac
gcggacggccacgaggaacgcctgcaggcgctgcacaagcgcgagcgcgaaacgggcttc
gacctgctgcgcgagccgcccttccatctgcggctgatccgcctgggcgaagcgcgctac
tggttcatgatgagcaaccatcacattctcatcgacgcctggtgccgcggcctgctgatg
ggcgacttcatggagatctacgccgccctcggcgagggccgcgagccgcggctgccgtcc
gcgccgcgctaccgcgactacatcgcctggctgcaacgccaggacttcgaggcggcgcgc
aactggtggcgcgacaacctgcgcggcttcgagcggccgaccgccatccccggcgaccgc
ccgctgctgcgcgagcacaccggcggcatgcaggtcggcgactgcctgacgcggctggag
gccgccgacggcgcgcgcctgcgcgaactcgcccagcgccaccaactgaccgtcaacacc
ttcgcccaggcggcctgggcgctggtgctgcaccgctacagcggcgaacgcgacctgacc
ttcggcgtcaccgtggctggacggccggtgagcatgccggcgctgcaaggcaccgtcggc
ctgttcatcaacagcatcccgctgcgcctgcgcctgccggaagcgggcgagcgccgcgcg
gtgcgcgactggctgcgcgaactgctggaacgcaacctggaactgcgcgagtacgaatac
ctgtcgctggtggacatccaggaatgcagcgagctgcccaagggccagccgctgttcgac
agcctgttcgtgttcgaaaacgcgccggtggacagcgcggtgctggaccgcgcccagggc
ctcaaggcccgctccgagtccggacgcacccacaccaacttcccgctcaccgtggtctgc
tacccgggcgacgacctgggcctgcacctgtcctacgaccggcgctatttcgaggccgcg
accatcgagcgtttgctcggcgacttcaagcgcctgctgctggccctggccgacggcatc
ctcggcgacctgtccgacttgccgctgctggaccacggcgagcgcgaattcctgaccgag
ggctgcaaccgcagcgagcgcgactacccgctggagcagggctacgcacggctgttcgag
gcacgggtggcggcgcatcccgagcggatcgtcgcccgttgtcaggacgcacagtggaac
tacgcagggctgaacgcgcgcgccaaccgcctgggccacgccctgcgcgcggccggcgtg
ggagtcgaccagccggtggcgctgctcgccgagcgcggcctcgacctgctcggcatgatg
atcggtgccttcaaggccggcgccggctacctgccgctcgacccgggccatccggcccag
cgcctgacccgcatcctcgaactcggccgcgtgccgctgctggtctgctcggcggcgtgc
cgcgcgcaggccgtcgagctgctggaggcgctggccggccagggacgtccgcgcctgctg
gtgtgggacgaggtgcaggcgggcgactggccgacggcgaaccccggcgtctacagcggc
ccggacagcctcgcctacgtgatctacacctccggctccaccggactgcccaagggggtg
atggtcgagcaggccgggatgctcaacaaccagttgtccaaggtgccctacctgggcctg
gacgaagccgatgcgatcgcccagaccgcctcgcagagcttcgatatctcggtctggcag
ttcctcgccgcgccgctgttcggcggccgggtggagatagtgccgaacgccatcgcccac
gatccgggcgccctgctggccctggcgcgcgagcgcggcgtcacggtgctggaaagcgta
ccctcgctgatccagggcatgctcgccgaggagcgggacgggctcggcgcgctgcgctgg
ctgctgcccaccggcgaggcgatgccgccggaactggcccgccagtggctgcagcgttac
ccgcaggtggggctggtcaacgcctacggaccggcggaatgctcggacgacgtggcgctg
ttccgcgtcgacatggaggccaccgccggcagctacctgcccatcggcagtcccaccgac
aacaaccgcctgtacctgctcgacgaggcgctggaactggtgccggccggcgcgacgggc
gaactgtgcatcgccggcaccggcgtcggccgtggttacgtgggcgatccgctgcgcacc
gcgctggccttcctgcccaaccccttcgcccgcgagcccggcgagcgtctgtaccgcagc
ggcgacctggcgcggcggcgcgtcgacggcctgctggagtacgtcgggcgcatcgaccat
caggtgaagatccgcggcttccgcatcgaactgggcgagatcgaggcgcacctgcacgaa
caggcggaagtccgcgaggccgccgtggcggtgcaggaggggccgaacggcaagtacctg
gtcggctacctggtgcccgccgacatggaactggcggaggtttccccggccaccgcgccg
ctgctgcacggcgagctgttcgagcgcgtcaagcagcgtctgcgcgccgaactgcccgac
tacatggtaccggcgcactggctgctgctggagggcctgccgcgcaacaccaacggcaag
ctggaccgcaaggcgctgccggaactggagatcggccagtcgcgcgggcaggcctacctg
gcgccgcgcaacgatctggaacggaccctggcgacgatctgggcggagctgctcaaggtg
gagcgggtcggcgtgcacgacaacttcttcgaactgggcgggcactccctgctggccacc
cagatcgcctcgcgggtgcagaaggcactgcagcgcaacgtaccgctgcgggcgatgttc
gagtgcagcacggtgggcgaactggccgcctacatcgaatcgctggagggctcggccctc
accgaacagaaggccagccgcctcgacgacctgatgtcgcggctggaggcgctgtga

DBGET integrated database retrieval system