KEGG   Archaeoglobus veneficus: Arcve_1477Help
Entry
Arcve_1477        CDS       T01451                                 

Definition
(GenBank) Y414 protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
ave  Archaeoglobus veneficus
Brite
Enzymes [BR:ave01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Arcve_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AEA47480
JGI: Arcve_1477
UniProt: F2KP76
LinkDB All DBs
Position
complement(1313626..1314768)
Genome map
AA seq 380 aa AA seqDB search
MKFVAQALGLSEPAARKLEDRNILREAVIKHPFFADIIEAYNLEKKFGAYEEGTLIAKTN
NSLEVIRGYPKIRRALVLYPTLKKHFKGEVAIEEKMNGYNVRIVKMGSNLYAVTRRGFIC
PYTTEKARLVFEMDFFRDNPHLMLCCEAVGDESPFVPKDIYGSGVHFYVFDIRVKKTNEP
LGVREKEKVAEEYGFRLAPILEFADVKRAHEAVIEAVEKLGRQGREGVVIKDVSMKRPPV
KYTTSQSNCSDLSYAFRYFNEYARDFMISRIVREAFQSFEFKESEEEFRQRCLRLGESIL
RPMVESIRDVKEKGRVAEKSKLRFYNLEVFELFKEHLRRMGVDARFSEPAEDNGSYIVFM
ERYMMSTTDKISNLLKGGFW
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgttgcccaggctctcggcctctccgagcctgcagcccggaagctcgaggat
agaaacattctgagagaagcggtaataaaacaccctttttttgccgatattatcgaggcg
tacaaccttgaaaagaagtttggtgcctacgaggagggcacgcttatagcaaaaacgaac
aacagccttgaggttataaggggttatccaaagataagacgggcgctggttctctacccg
actttaaagaaacacttcaaaggtgaggtggcgatagaagagaagatgaacggatacaac
gtcaggatagtaaaaatgggtagcaacctgtatgccgtgacgagaagaggctttatctgt
ccttatactactgagaaagcaaggcttgtattcgaaatggacttcttccgcgacaatccc
catctcatgctgtgctgcgaggccgttggagacgaatcaccattcgtgcccaaggatatc
tacggcagcggagtacacttctacgtcttcgacatccgggtgaagaaaaccaacgaacct
cttggtgttagagagaaggagaaggttgcagaagagtatggattcagacttgcacctata
ctcgagtttgctgacgtgaagagggcgcacgaagctgttatagaagcggtggagaaactc
ggcaggcagggaagggagggcgtggttataaaggatgtatcaatgaagagacctccggtg
aagtacaccaccagccagtccaactgctcggatttgagctatgccttcagatacttcaac
gaatacgcgagggatttcatgatctcccggattgttagagaagcgttccagagtttcgag
ttcaaagagagtgaggaggaattcaggcagcgctgtttaaggcttggcgaatccatccta
aggccgatggtggagagcataagggatgtgaaggaaaaagggagggttgcggagaaatct
aagttgcgcttttacaacctcgaagttttcgaactatttaaagaacatctgaggaggatg
ggagtagacgcgcgattttctgaaccagcagaggacaatggaagctacattgttttcatg
gagaggtacatgatgagcacgactgacaagatatcgaatctccttaaaggggggttctgg
tga

DBGET integrated database retrieval system