KEGG   Azotobacter vinelandii CA: AvCA_06090Help
Entry
AvCA_06090        CDS       T02633                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
avl  Azotobacter vinelandii CA
Brite
Translation factors [BR:avl03012]
 Eukaryotic Type
  Elongation factors
   AvCA_06090 (tuf)
 Prokaryotic Type
   AvCA_06090 (tuf)
Mitochondrial biogenesis [BR:avl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AvCA_06090 (tuf)
Exosome [BR:avl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AvCA_06090 (tuf)
  Exosomal proteins of breast cancer cells
   AvCA_06090 (tuf)
  Exosomal proteins of colorectal cancer cells
   AvCA_06090 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
588998..590191
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCAETWGGAARAFDQIDNAPEEKARG
ITINTSHVEYDSATRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIITGSALMALE
GKDDNGIGVSAVRKLVETLDSYIPEPVRAVDQPFLMPIEDVFSISGRGTVVTGRVERGIV
KVGEEVEIVGIRPTTKTTCTGVEMFRKLLDEGRAGENIGALLRGTKREDVERGQVLAKPG
TIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNVELPEGVEMVMPGDNI
KMTVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagttcgagcgtaacaagccgcacgtcaacgttggcaccatcggtcac
gtggaccatggcaagaccactctgacggccgctctgaccaaggtttgtgccgagacctgg
ggtggcgccgctcgtgccttcgatcagatcgacaacgctccggaagaaaaggcgcgcggt
atcaccatcaacacctcgcacgttgaatacgactccgcgacccgtcactacgcgcacgtc
gactgtcccggtcatgccgactacgtgaagaacatgatcaccggcgccgcccagatggac
ggcgcgatcctggtctgctcggccgccgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgccaggtaggcgttccctacatcgtcgtgttcctgaacaaggccgacatg
gtcgacgacgccgaactgctggaactggtcgagatggaagtgcgtgatctgctgtccacc
tacgacttcccgggcgacgacaccccgatcatcaccggctctgccctgatggcgctggaa
ggcaaggacgacaacggcatcggcgtctccgccgtgcgtaagctggtggaaaccctggac
tcctatattccggagccggtgcgtgccgtcgatcagccgttcctgatgccgatcgaggac
gtgttctcgatctccggccgcggcaccgtggtgaccggtcgcgtcgagcgcggcatcgtc
aaggtcggcgaggaagtggaaatcgtcggtatccgtccgaccaccaagaccacctgcacc
ggcgtggaaatgttccgtaagctgctcgacgaagggcgtgccggcgagaacatcggcgcc
ctgctgcgcggcaccaagcgtgaggacgtggagcgcggccaggttctggccaagccgggc
accatcaagccgcacaccaagttcgaagccgaagtgtatgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgcccgcagttctacttccgtaccaccgac
gtgaccggtaacgtcgagctgccggaaggcgtcgagatggtgatgccgggtgacaacatc
aagatgaccgtcaccctgatcgctccgatcgccatggaagacggtctgcgtttcgccatc
cgcgaaggcggtcgtaccgtcggcgccggtgtggtggccaagatcatcgagtaa

DBGET integrated database retrieval system