KEGG   Aeromonas veronii TH0426: AMS64_04655Help
Entry
AMS64_04655       CDS       T04529                                 

Definition
(GenBank) aldose epimerase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
avo  Aeromonas veronii TH0426
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:avo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMS64_04655
Enzymes [BR:avo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AMS64_04655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
976070..976936
Genome map
AA seq 288 aa AA seqDB search
MQSIRPLTANCKLANNAAGLPVLTINNDYAKAEISLFGAHVLSYQRHGEPASIWLSDKAV
LDGSKPVRGGIPICWPWFGPAPARVGSGKPSHGFARTTLWMLDGVSDHADGTLVHLSLRD
SDATRALWDHAFELELDVLVGKELSLVLTTRNTGAQSLTYSGALHTYLQISAPEAVSVTG
LGEPYADKLTGQDAKQQGALTLSGPLDRVYWQPEALVSVQDGERETRVVSGNHDSMVVWT
PWLEGATAMADMSDDGYLTMLCVEAAIAGEAGVTVAPDEEHSLSTVII
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccattcgtcccctgacagccaattgcaagcttgccaacaatgcggccggtctg
ccggttctcaccatcaacaacgactatgccaaggcagaaatcagcctgtttggcgcccat
gtgctgagctatcagcgtcatggcgagccagcctccatctggttgagcgacaaggcggtg
ctggatggcagcaagcctgttcgcggtggtatcccgatctgctggccctggtttggcccg
gcgcccgcccgcgtcggtagcggcaagccctcccacggttttgcccgcaccaccctctgg
atgctggacggagtctccgatcacgctgatggcacgcttgttcatctctccctgcgcgat
agcgatgcgacccgtgccctgtgggatcacgccttcgagctggagctggatgtactggtt
ggcaaagagctctcgctggtgctgaccactcgcaacacaggtgctcagtcgctgacttat
agcggtgcgctgcacacctatttgcagatcagcgcaccggaggcggtaagcgtcaccggc
ctgggtgagccctatgccgacaagctgaccgggcaggatgccaagcagcagggggcattg
accctgagtgggccgctggatcgggtctactggcagccagaggcgctggtgagcgtgcag
gatggtgagcgcgagacccgggttgtcagtggcaaccacgacagcatggtggtctggacc
ccctggctggaaggggctaccgccatggccgacatgagcgatgacggctatctcaccatg
ctctgtgtcgaagcggccatcgccggcgaggcgggtgtgaccgtcgcgccggatgaagag
cacagcctctccaccgtaatcatctga

DBGET integrated database retrieval system