KEGG   Aeromonas veronii B565: B565_2860Help
Entry
B565_2860         CDS       T01462                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
avr  Aeromonas veronii B565
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B565_2860
   00650 Butanoate metabolism
    B565_2860
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B565_2860
   00280 Valine, leucine and isoleucine degradation
    B565_2860
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B565_2860
Enzymes [BR:avr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B565_2860
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     B565_2860
Amino acid related enzymes [BR:avr01007]
 Aminotransferase (transaminase)
  Class III
   B565_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3217693..3218982
Genome map
AA seq 429 aa AA seqDB search
MSQSESNKAWQARREAAVVNGVGTLLPVFIDRAQNAELWDVEGNRYIDFASGIAVLNTGH
NHPKVVAAVREQLEKFSHTCFQVTPYPGYIELAEKLNALVPGPTPKRTLFLSTGAEAVEN
AIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHIPFPADYLG
VSEEDALHALELCFSADIEPSRVAAIIIEPVQGEGGFYPASPSFMQKLRSVCDQHGILLI
CDEIQSGFCRTGKTFATEYAGIEPDIMTLAKSLAGGFPLSAVVGKAEIMNSAKPGGLGGT
YAGSPIACAAALTVLQVIEEEQLNQKAQAQGEQIKAGLQRIAERFDCIGQIRGPGAMVAM
ELVKRRDASQPDPDLTKRLVAEAGKRGLVLLSCGVRANVIRFLAPLTAPAAVIDEGLQLL
EKSLEAVLA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtcagaatcaaacaaggcgtggcaagcgcgccgcgaagcggccgtggtcaat
ggcgtcggtaccctgctgccggtctttatcgaccgggcgcaaaatgccgagctgtgggat
gtggagggcaaccgctacatcgactttgcctccggcatcgccgtgctcaacaccggtcac
aaccacccgaaagtggtggcagcggtgcgcgagcagctggaaaaattcagccacacctgc
tttcaggtcactccctacccgggctatatcgagcttgccgagaagctcaacgccctggtg
cccggcccgaccccgaagcgcaccctgtttctctccaccggcgccgaggcagtcgagaac
gccatcaagattgcccgcgcccacaccggtcgcagcggcaccatcgccttcaaggggggc
tttcacggccgcaccatgatggggatggcgctcaccggcaaggtggtgccctacaagacc
ggctttggccccttcccgggggaggtctaccacatccccttccccgccgattatctcggg
gtgagtgaagaggatgccctgcacgccctcgagctctgcttcagcgccgatatcgagccg
agccgggttgccgccatcattatcgagccggtacagggcgaagggggcttctatcccgcc
tccccgagctttatgcagaagctgcgcagcgtctgcgaccagcacggcattctgctgatt
tgtgacgagatccagagcggtttctgccgcaccggcaagaccttcgccaccgagtatgcc
ggcatcgagccggacatcatgaccctggccaagagtctggcgggtggcttccccctgtca
gccgtggtgggcaaggcggagatcatgaactcggccaagccgggtggtctgggtggcacc
tatgccggttcccccatcgcctgcgctgccgcgctgacggtcttgcaggtgatcgaagag
gagcagctcaaccagaaggcccaggcgcaaggtgagcagatcaaggcggggctgcaacgc
atagccgagcgttttgactgcataggtcaaattcgcggccccggtgccatggtggccatg
gagctggtgaaacggcgtgatgccagccagcccgatcccgaccttaccaagcgactggtg
gccgaggcgggcaaacggggtctggtccttctctcatgcggggtgcgcgcaaatgtcatc
cgttttctcgcccccctgacagcccctgcggcagtgattgacgaggggttgcaactcctt
gaaaaatcactggaggccgtgctggcctga

DBGET integrated database retrieval system