KEGG   Aeromonas veronii B565: B565_3717Help
Entry
B565_3717         CDS       T01462                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
avr  Aeromonas veronii B565
Brite
Translation factors [BR:avr03012]
 Eukaryotic Type
  Elongation factors
   B565_3717
 Prokaryotic Type
   B565_3717
Mitochondrial biogenesis [BR:avr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B565_3717
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B565_3717
  Exosomal proteins of breast cancer cells
   B565_3717
  Exosomal proteins of colorectal cancer cells
   B565_3717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AEB51752
LinkDB All DBs
Position
complement(4183980..4185164)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITNVLAKHFGGKAFAFDQIDKAPEERERG
ITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPYMIVFMNKCDMVDDEELLELVEMEVRELLTEYDFPGDDLPVVRGSALKALE
GDAQWEEKIIELAGHLDTYIPEPERAIDQPFLMPIEDVFSIAGRGTVVTGRVERGIVKVG
ETVEIVGIKDTVSTTCTGVEMFRKLLDEGRAGENIGALLRGVKREDVERGQVLAKPGSIK
PHTKFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIAPIAMDDGLRFAIREGGRTVGAGVVASVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgagcgtaataaaccgcacgtaaacgtcggcaccatcggccac
gttgaccacggtaaaaccaccctgactgcagctatcaccaacgtgctggccaagcacttc
ggtggtaaagctttcgccttcgaccagatcgacaaggcaccggaagagcgtgagcgtggt
atcaccatcaacacctcccacgtagaatacgacaccgctacccgtcactacgcccacgta
gattgcccgggtcacgccgactacgttaaaaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtagtagcagcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggttggtatcccgtacatgatcgtgttcatgaacaagtgtgacatg
gttgatgacgaagagctgctcgaactggtagagatggaagttcgtgaactgctgaccgag
tacgacttcccgggtgatgacctgccggtagttcgtggttccgcgctgaaagcgctggaa
ggcgacgctcagtgggaagagaagatcatcgaactggctggccacctggatacctacatc
ccggagccggagcgcgcgattgaccagccgttcctgatgcctatcgaagacgtattctct
atcgctggccgtggtaccgtagttaccggtcgtgtagagcgcggtatcgttaaagtaggt
gaaactgtagaaatcgttggtatcaaagataccgtttctaccacctgtaccggtgttgaa
atgttccgtaagctgctggacgaaggtcgtgcaggcgagaacatcggcgcgctgctgcgt
ggtgttaagcgtgaagacgtagagcgtggtcaggtactggccaagccgggttctatcaag
ccgcacaccaagttcgaatctgaagtgtacgtactgtccaaagaagaaggtggtcgtcat
accccgttcttcaaaggctaccgtccgcagttctacttccgtactaccgacgtgaccggt
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgattgcgccgatcgcgatggacgacggcctgcgtttcgctatccgtgaaggt
ggccgtaccgtaggtgctggtgttgtagctagcgtaatcgcctaa

DBGET integrated database retrieval system