KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_00315Help
Entry
ERS451415_00315   CDS       T04522                                 

Gene name
aldHT
Definition
(GenBank) Aldehyde dehydrogenase%2C thermostable
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:axx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ERS451415_00315 (aldHT)
Enzymes [BR:axx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ERS451415_00315 (aldHT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC RbcS
Motif
Other DBs
NCBI-ProteinID: CKG73822
UniProt: A0A0D6FK09
LinkDB All DBs
Position
1:333561..335021
Genome map
AA seq 486 aa AA seqDB search
MDDLSQQVFLNYIGGEWVACASGVTAPNLNPADTSDVVGRFQQSDADDAARAVKAAADAF
AAWRDTPISKRAAILFRAAQHLEDHADEVARELTREEGKGLALARDEVLRSAQTIRFYAV
EGQSFTGETFVNDDPDMVVYSQREPLGVVTVISPWNFPISIPARKIAPALITGNTVVFKP
SSDAPLTGYRLTEAFVEAGLPPGVLNFVTGPASKVGQAITTAAAVRAISFTGSTAAGEQI
HRGADLTTRTQMELGGKNPLIVLADADLDRAVDLAVKGGFSLSGQACTGTSRLLVDRKVL
AAFTDKLLARMRKLTIGNGLEGNFDLGPLATRKQLDTVLSYIAVGKQEATHLIGGERLDG
PGFERGYYVTPALFTDVTQQMRIAREEIFGPVLALIAVDGYDEAIACANDTEYGLSAAIA
TSDARYAHRFARDIQAGTVKINRTTTGNLINAPFGGLKSSSTSTFRESGRVGLEFYTQIK
TVYRAG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtggacgatctctcgcagcaggtttttctcaactacatcggcggggaatgggtggcctgc
gcttcgggcgtcacggcgcccaacctgaacccggccgacacgtccgacgtggtggggcgc
ttccagcaatcggacgcggacgacgccgcccgcgccgtgaaggccgctgcggatgccttc
gccgcctggcgcgacacgccgatctccaagcgtgccgccatcctgttccgtgccgcccag
cacctggaagaccacgccgacgaggtggcgcgcgagctgacccgcgaggaaggcaagggc
ctggcgctggcgcgcgacgaggtcctgcgttcggcccagaccatccgcttttacgcggtg
gagggccagtcgttcaccggcgagaccttcgtcaacgacgatcccgacatggtggtctac
agccagcgcgagccgctgggggtggtgacggtgatctcgccgtggaatttcccgatctcg
atcccggcccgcaagatcgcgccggcgctcatcacgggcaacacggtggtgttcaagccc
tcgtccgatgcgccgctgaccggctaccggctcaccgaggccttcgtcgaggcgggcctg
ccgccgggcgtgctgaatttcgtgaccgggccggcctcgaaggtgggccaggccatcacc
acggcggcggcggtgcgcgccatttccttcaccggctcgaccgcggccggcgagcagatc
catcgtggcgccgacctgaccacgcgcacgcagatggagctgggcggcaagaacccgctg
atcgtgctggccgacgccgacctggatcgcgcggtggacctggcggtcaagggcggcttt
tcgctcagcggccaggcctgcaccggcaccagccgcctgctggtcgatcgcaaggtgctg
gcggcgttcaccgacaaactgctggcgcgcatgcgcaagctgaccatcggcaacggcctg
gagggcaatttcgacctgggaccgctggccacgcgtaaacaactcgacacggtgctgagc
tacatcgcggtgggcaagcaggaagccacccacctgatcggcggcgagcgcctggacggt
ccgggcttcgagcgcggctattacgtgacgccggccctgttcacggacgtgacgcagcag
atgcggatcgcgcgcgaggaaatcttcggccccgtgctggcgctgatcgcggtggacggc
tacgacgaggccatcgcttgcgccaacgacaccgaatacggcctgtccgcggccatcgcc
accagcgacgcgcgctacgcccaccgcttcgcccgcgacatccaggccggcaccgtcaag
atcaaccgcaccaccacgggcaatctcatcaacgcgccgttcggcggcctgaaaagctcc
agcacgtcgacgttccgtgaatcgggccgggtcgggctggagttctacacgcagatcaag
accgtctaccgcgccggctga

DBGET integrated database retrieval system