KEGG   Achromobacter xylosoxidans A8: AXYL_03487Help
Entry
AXYL_03487        CDS       T01341                                 

Gene name
glpD2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AXYL_03487 (glpD2)
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AXYL_03487 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3753777..3755375
Genome map
AA seq 532 aa AA seqDB search
MNQPLASVAPPDRNRLLNTLDNTHSWDVIVIGGGATGLGTAVDAASRGYRTLLIEGADFA
KGTSSKATKLVHGGVRYLAQGNVSLVREALHERGLLNRNAPHLVWPLGFVVPAYNLFDQP
FYGVGLKMYDMLAGKLNLAPSRWLSRRDTLANAPTLAENVQGKNLKGGVLYYDGQFDDAR
LAMSLMRTLFDLGGTAVNYMRATGLTMTGGKVDGVTVQDAIGGASFTLRARCVVNATGVW
VDAVRRMEDKNAQTMVAPSQGVHLTLPQDFLPGKRAILIPKTDDGRVLFVVPWNGHTIVG
TTDTPRDDLPLDPQAGAQDVDFILSTAARYLSRKPTRDDVTSVWAGLRPLVKATGEASTK
SLSREHTILVSKAGLVTVTGGKWTTYRRMAQDVVDTAIQHQLLTQATCRTESLPLHGAAG
LAPSQEHAGTPDSYYGSDLPTLKALPGAERMLVKSSGLSEAHVRFAARYELARSAEDVLA
RRNRALFLDAEAAMLAAPEVARILAEELGHDAAWQQRTLQDLEVVAANYRLK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaccgctagcctccgtcgccccgcccgaccgcaaccgcctcctgaacacgctg
gacaacacgcactcctgggacgtgattgtcatcggcggcggcgccaccggcctgggcacg
gccgtcgacgccgcttcgcgcggctatcgcaccctgctgatcgaaggcgcggacttcgcc
aagggcacttccagcaaggccaccaagctggtgcatggcggcgtgcgctatctggcgcag
ggcaatgtcagcctggtgcgcgaagcgctgcatgaacgcggcctgctcaaccgcaatgcg
ccgcacctggtgtggccgctgggcttcgtggtgccggcctacaacctgttcgaccagccc
ttctacggcgtcggcctgaagatgtacgacatgctggccggcaagctgaacctggcgccc
agccgctggctgtcgcgccgcgacacgctggccaacgcgccgaccctggccgagaacgtg
cagggcaagaacctcaagggcggcgtgctgtattacgacggccagttcgacgacgcgcgc
ctggcgatgagcctgatgcgcacgctgttcgacctgggcggcacggcggtgaactacatg
cgcgccaccggcctgaccatgacgggcggcaaggtcgacggcgtgacggtgcaggacgcg
ataggcggcgccagcttcacgctgcgcgcgcgctgcgtggtcaacgccaccggcgtgtgg
gtagacgcggtgcgccgcatggaagacaagaatgcgcagaccatggtcgcgcccagccag
ggtgtgcacctgaccttgccgcaggatttcctgccgggcaagcgcgccatcctgatcccc
aagaccgacgacggccgcgtgctgttcgtggtgccatggaacggccacaccatcgtcggc
accaccgatacgccgcgcgacgacctgccgctggatccgcaggcgggcgcccaggacgtg
gatttcatcctgagcacggcggcgcgctacctcagccgcaagcccacgcgcgatgacgtc
accagcgtctgggccgggctgcgtccgctggtcaaggccaccggcgaagcctccacaaag
tcgctgtcgcgcgagcacaccatcctggtgtccaaggccgggctggtgaccgtcaccggc
ggcaagtggaccacctaccgccgcatggcgcaggacgtggtggacacggccatccagcac
cagctgctgacgcaggctacctgccgcacggaatcgctgccgctgcacggcgcggcgggc
ctggcgccctcgcaggaacatgccggtacgccggacagctactacggcagcgacttgccg
accttgaaggcgctgcctggcgccgagcgcatgctggtcaagagcagcggcctgtcggag
gcgcacgtgcgtttcgccgcgcgctacgaactggcgcgcagcgccgaggacgtgctggcg
cgccgcaaccgcgccctgttcctggacgccgaggctgcgatgctggccgcgccggaagtg
gcgcgcatcctggcggaagagctgggacacgatgccgcctggcagcagcgcaccttgcag
gaccttgaagtggtcgcggcgaattaccgtctcaagtag

DBGET integrated database retrieval system