KEGG   Ilumatobacter coccineus: YM304_14010Help
Entry
YM304_14010       CDS       T02501                                 

Definition
(GenBank) aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
aym  Ilumatobacter coccineus
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aym00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YM304_14010
   00650 Butanoate metabolism
    YM304_14010
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YM304_14010
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YM304_14010
Enzymes [BR:aym01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     YM304_14010
Amino acid related enzymes [BR:aym01007]
 Aminotransferase (transaminase)
  Class III
   YM304_14010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1569797..1571086
Genome map
AA seq 429 aa AA seqDB search
MTMTNDLDERYRSVFPSWLSPLYAEPISIERGEGSYVWDLEGERYLDFFGGVLTTMIGHN
QPDVTAAVQAQAAKVMHTSTLYLNQPMIELAEEIAEVSGIPDARVFFTASGSEANDTALL
LATSYRKSNQVLAMRNSYHGRSFTTQAITSHSSWSSTSTSGLDVHFVQGGYRLRSPFRDL
DDDAFTQACCDDLEQILDMTSAGSVAALIAEPIQGVGGFAIPPDGFFGQFQKILQNRDIL
FISDEVQTGWGRTGEHFWGYQAHGVTPDILTFAKGVGNGAGLAGVVARADVMDTIKVASF
STFGGNPLAAAAGLATLRHVRANDLQTNAKRMGERLRNGLHAGIGDVPWIGEVRGRGLML
AIETVHDDSLHPDPSKALAIAEGCKARGLLVGKGGLYGNVVRMAPMLNSTESEIDEGVAA
LVATIEAIA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgacgaacgatctcgacgagcgctatcgctcggtcttcccgtcgtggctgtcg
ccgctctacgccgagccgatctcgatcgagcgcggcgaaggcagctacgtctgggacctc
gaaggcgagcgctacctcgacttcttcggcggggtgctcaccaccatgatcgggcacaac
cagcccgacgtgaccgccgccgtccaggcgcaggccgccaaggtcatgcacacctcgacg
ctgtatctcaaccagccgatgatcgagttggccgaggagatcgccgaggtgtcgggcatc
cccgacgctcgtgtcttcttcaccgcgtcgggcagtgaggccaacgacacggcgctgctg
ctcgccacgtcgtaccgcaagtcgaaccaggtgctggcgatgcgcaacagctatcacggc
cgttcgttcaccacgcaggcgatcacgtcgcactcgtcgtggtcgtcgacgagcacgtcg
ggtctcgacgtgcacttcgtgcagggcggctaccggcttcgcagcccgttccgcgacctc
gacgacgacgcgttcacccaggcctgctgtgacgacctcgaacagatcctcgacatgacc
agcgccggctcggtcgccgcgctcatcgccgagccgatccagggcgtcggcggtttcgcg
atcccgcccgacgggttcttcggccagttccagaagatcctgcagaaccgcgacatcctg
ttcatcagcgacgaggtgcagacgggctggggccgcaccggcgagcacttctggggctac
caggcccacggcgtcacgcccgacatcctcaccttcgccaagggcgtcggcaacggtgcc
ggactcgccggggtggtggctcgcgccgacgtgatggacacgatcaaggttgcgtcgttc
tccacgttcggtggcaacccgctcgccgcagcagccgggctcgccacactccgacacgtg
cgcgccaacgacctgcagaccaacgcgaagcgcatgggcgagcggctgcgcaacggactc
cacgccggcatcggcgacgtgccctggatcggggaggtgcgcggccgcggcctgatgctg
gcgatcgagaccgtgcacgacgattcactgcatcccgacccgtcgaaggccctcgccatc
gccgaaggatgcaaagcacgcggactgctggtgggcaagggcggcctctatggcaacgtg
gtccgcatggcgccgatgctcaacagcaccgagagcgagatcgacgaaggcgtggcggcg
ctcgtcgccaccatcgaggcgatcgcctga

DBGET integrated database retrieval system