KEGG   Azoarcus sp. KH32C: AZKH_1207Help
Entry
AZKH_1207         CDS       T02502                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aza  Azoarcus sp. KH32C
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AZKH_1207
Enzymes [BR:aza01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AZKH_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1328196..1329761
Genome map
AA seq 521 aa AA seqDB search
MTAIVEGPLSRSALLGRLRAAGAWDVVVIGGGATGLGCAVDASARGYRTLLLEAHDFAKG
TSSRATKLIHGGVRYLAQGNLPLVHEALAERSRLLANAPHLVHPLRFVVPAYHWLDIPKF
GAGLTFYDLLAGGHGIGRSRVLDAASTVVALPTVNPDGLRGGIAYWDAQFDDARLAIALM
RTHLDLGGLALNYLPVDGLVQEGGRVRGVLAHDAETGETFHMAARTVINATGVWADSVRR
FERSQVSAMLKPSQGVHLVVDRDFLPGMDALLVPETPDGRVLFVIPWCGKVLIGTTDSPR
KDLPLEPEPLAGEIDFILATAAPYLVRAPSREDVRSVFVGLRPLIGAGDSSATRSLSREH
CIEVSPGGLVTITGGKWTTYRRMAEEAVDTAQSVGSLPSRSGATASLRLHGAPTARSSAS
RDVYGTARAEVDSLPGAARAVSPSFALTEAEIRYAARAELARSVEDVLARRHRALFLDAK
AAVVAAPEVARILAEELGRDAAWCSGEVERFSVLAAQYARL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgatcgtcgaaggtccgttgtcgcgttcggctttgctcggtcgcctgcgtgcg
gccggtgcgtgggacgtcgtcgtgatcggcggcggtgcgaccgggctcggctgcgcggtc
gatgcgagcgcccgcggctatcggacgctgttgctcgaggcgcacgatttcgccaagggc
acgagttcgcgtgcgacgaagctgatccacggcggcgtgcgctatctcgcccagggcaat
ctgccgctcgtgcacgaggcgctggcggagcgctcgcggctgctggcgaacgcgccccat
ctcgtccatcccttgcgcttcgtcgtgcccgcctaccactggctcgacattccgaaattt
ggcgccggcctgactttctacgatctgcttgcgggcggtcacggcatcgggcgcagccgc
gtgctcgatgccgcgagcacggtcgtcgccctgccgaccgtgaatcccgacggattacgc
ggcggtatcgcctattgggatgcgcagttcgacgacgcgcgcctcgcgatcgcactgatg
cgcacccatctcgatctgggcggactcgcgctcaactacctgcccgtcgatggcttggtg
caagagggcggacgagtgcgcggcgtgctcgcgcacgatgccgagaccggagagacgttc
catatggcggcacgcaccgtcatcaacgccaccggcgtgtgggcggactcggtgcggcgc
ttcgagcgatcgcaggtgtctgcgatgctcaagccgagccagggcgtgcatctggttgtc
gatcgcgacttcctgcccggcatggacgcgctgctggtgccggagacgccggacggtcgc
gtgctgttcgtgattccgtggtgcggcaaggtgctgatcggcacgacggattcgccgcgc
aaggacctgccgctggagccggagccgctcgcgggcgagatcgacttcatcctcgcgacg
gcggcgccctatctcgtccgcgcaccgtcgcgtgaggatgtgcgtagcgtgttcgtcgga
ttgcgccccttgatcggcgcgggcgacagttcggcgacgcggtccttgtcgcgcgagcat
tgcatcgaggtctctcccggcgggctcgtgacgatcaccggcggcaagtggacgacctac
cgtcgaatggccgaggaggcggtcgatacggcgcagtcggtcggaagcctgccgtcgaga
agcggcgcaacggcgagccttcgtctgcatggcgcgcccaccgcgcgctcgtccgcatcc
cgcgacgtctatggcacggcgcgggcggaggtcgacagcctgcccggcgcggcccgcgcg
gtgtccccgagctttgcactgacggaggccgaaattcgctacgctgcacgggcggaactc
gcgcgcagcgtcgaggacgtgctggcccgccggcatcgtgcgctcttcctcgatgccaaa
gccgcggtggtggcggcgccggaagtggcacgcatcctggccgaagaactcgggcgcgat
gcagcctggtgcagcggcgaggtcgagcgtttctcggttcttgccgcacaatacgcacgc
ttgtag

DBGET integrated database retrieval system