KEGG   Azorhizobium caulinodans: AZC_0685Help
Entry
AZC_0685          CDS       T00609                                 

Gene name
nrtB
Definition
(GenBank) nitrate transporter component
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
azc  Azorhizobium caulinodans
Pathway
azc00910  Nitrogen metabolism
azc02010  ABC transporters
Module
azc_M00438  Nitrate/nitrite transport system
azc_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AZC_0685 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AZC_0685 (nrtB)
Transporters [BR:azc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    AZC_0685 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: BAF86683
RhizoBase: AZC_0685
UniProt: A8IPS4
LinkDB All DBs
Position
complement(756480..757388)
Genome map
AA seq 302 aa AA seqDB search
MSVTALKEAEPQRRPEAATPASVAQVVRLKRSRPPVSARLMAAARWFAVSVLPPLIVTAL
LLLLWELLCRGAGATLPPPSRIWADSKDLIVDPFFVAGPQDIGLGLRVLVSLQRVAVGFG
LAAVVGVLTGALIGQSVWAMRGLDPIFQMLRTVPPLAWLPLALAAFRDSNPSAIFVIFIT
SIWPIIINTAVGIRNIPQDYRNVAQVLRLNPLEFFWKIMLPSAAPYIFTGLRIGVGLSWL
AIVAAEMLTGGVGIGFFIWDAWNSSRLPDIIVALVYIGVVGFVLDRLVAGVAGIVTRGTA
AS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaccgccctcaaagaggccgagccgcagcggcgtcccgaagccgccacgcct
gcgagcgtcgcgcaggtcgtccgcctgaagcggtcgcgcccgcccgtctccgcccgcctc
atggccgccgcacgctggttcgcggtgagcgtgctgccgccgctcatcgtcacagccctg
ctgctgctactgtgggaactgctgtgccggggcgccggggcgaccctgcctccgccgagc
cgcatctgggccgacagcaaggatctgatcgtcgatcccttcttcgtcgccggcccgcag
gacatcggcctcggcctgcgcgttctcgtgtcgctccagcgcgtggcggtgggcttcggc
ctcgccgctgttgtgggcgtgctcaccggcgcgctcatcggccagtcggtctgggccatg
cgcgggctcgatcccatcttccagatgctgcgcacggtgccgccgctcgcctggctgccg
ctggcactcgccgccttccgcgacagcaacccctcggccatcttcgtgatcttcatcacc
tccatctggccgatcatcatcaacacggcagtgggcatccggaacatcccgcaggactat
cggaacgtggcacaggtgctgcggctgaacccgctggaattcttctggaagatcatgctg
ccctcggcggcgccctacatcttcaccggcctgcgcatcggcgtcggcctgtcctggctc
gccatcgtggcggcggagatgctcaccggcggcgtcggcatcggattcttcatctgggat
gcgtggaactcctcccgcctgcccgacatcatcgtcgccctcgtctacatcggcgtggtg
ggcttcgttctcgaccgtctcgtggccggtgtcgccggcatcgtcacccgcggcaccgcg
gcgtcctga

DBGET integrated database retrieval system