KEGG   Azorhizobium caulinodans: AZC_0880Help
Entry
AZC_0880          CDS       T00609                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
azc  Azorhizobium caulinodans
Brite
Translation factors [BR:azc03012]
 Eukaryotic Type
  Elongation factors
   AZC_0880
 Prokaryotic Type
   AZC_0880
Mitochondrial biogenesis [BR:azc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AZC_0880
Exosome [BR:azc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AZC_0880
  Exosomal proteins of breast cancer cells
   AZC_0880
  Exosomal proteins of colorectal cancer cells
   AZC_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
982046..983239
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETSGGATFTAYDQIDKAPEEKAR
GITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLARQVGVPALVVFLNKCDMVDDPELLELVELEVRELLSKYDFPGDDIPIVRGSALCAL
ENKSPELGAEAILKLMAEVDKYIPQPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGIV
KVGDEVEIVGIRPTVKTTVTGIEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVVCKPG
SVKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNI
SVDVQLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagctaagtttgaacgtaacaagccgcactgcaacattggcaccatcggccac
gttgaccacggcaagacctctctgacggccgcgatcacgaaggtgctcgccgagacgtcg
ggtggcgcgaccttcaccgcctacgaccagatcgacaaggcgccggaagagaaggcgcgc
ggcatcacgatctcgacggcgcacgtcgagtacgagacgcagaaccgccactatgcgcac
gtggactgccccggccacgccgactatgtgaagaacatgatcaccggcgcggcgcagatg
gacggcgcgatcctggtggtgtccgccgccgacggcccgatgccgcagacccgcgagcac
atcctgctcgcccgtcaggtcggcgtgccggcgctggtggtgttcctgaacaagtgcgac
atggtcgacgatccggagcttcttgagctggtcgagctcgaggtccgcgagcttctgtcc
aagtacgacttccccggcgacgacatcccgatcgtgcgcggctctgccctgtgcgcgctc
gagaacaagtctcccgagctcggcgccgaagccatcctgaagctgatggccgaggtggac
aagtatatcccgcagccggagcgtccggttgaccagcccttcctgatgccgatcgaagac
gtgttctcgatctccggccgcggcaccgtggtgaccggccgtgtcgagcgcggcatcgtg
aaggtgggcgacgaagtggagatcgtcggcatccgcccgacggtgaagaccaccgtcacc
ggcatcgagatgttccgcaagctgctcgaccagggccaggccggcgacaacgtcggcgtg
ctgctgcgcggtacgaagcgcgaggacgtggagcgtggccaggtggtgtgcaagccgggt
tcggtgaagccgcacaccaagttcaaggccgaagcctacatcctgacgaaggaagagggc
ggccgtcatacgccgttcttcaccaactaccgcccgcagttctacttccgcacgacggac
gtgaccggcgtggtgacgctgcccgaaggcaccgagatggtgatgccgggcgacaacatc
tcggtggacgtgcagctgatcgtcccgatcgcgatggaagagaagctccgcttcgccatc
cgtgagggcggccgcaccgtcggcgccggcgtcgtcgcctccatcatcgagtga

DBGET integrated database retrieval system