KEGG   Azorhizobium caulinodans: AZC_3367Help
Entry
AZC_3367          CDS       T00609                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
3896316..3898061
Genome map
AA seq 581 aa AA seqDB search
MSSFSSLVDMLRHQAQHTPDKRALVFSSGKPEIEPELSFAGLYAQAATLARQIADQTQPG
DRALLVFPSGLEFVVSYFACLMAGVVAVPLMPPRRNANQDSSAAIIADCAPVLALSPAGE
AEDPRGTLRQRLADGNVRHLPVALADNATDDLPARAIARQDLAFLQYTSGSTSTPKGVMV
SHANLLANLEMMRQRFGNHAGSTHVSWIPLYHDLGLILNLLEPLYVGATCVLMTPSGFMH
RPLNWLRNIARFEAEVAAAPNFAYHLCVDRFRADQMEGVDLSRWTLAVNGAEPVRAVTMA
RFAETFAPYGFNARTLHPTYGLAEATLVVSSAPRGSGVTVREVSAEGLKDRRIAPPKDAE
DRQPIVGCGLTMPGQSIAIVDPQTRRRAEPGAIGEIWVHGASVAGGYWNRPEESEATFRA
HIEDEPDAGPFLRTGDLGHLDADGELFIAGRIKDVIIIRGVNHYPQDIEGTVADAHPTLR
RDYGAVFCVTGEDGTEQVVLVQEVERTKRHAIDETEVFAAIRAAVVNNHEVNVAKIVLIR
PGTIPKTTSGKIQRSRTRQQWLDGTLEVWDPRAPESAAEAV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagctccttctcctcgctggtggacatgctgcgccatcaggcccagcacacgcccgac
aagcgcgccctcgtcttctcttccggcaagccggagatcgagccggaactaagcttcgcc
ggcctctacgcgcaggccgcgacgctggcgcggcagattgcggatcagacgcagcccggc
gaccgggcgctgctcgtcttcccgtccgggcttgagttcgtcgtctcctatttcgcctgc
ctcatggcgggcgtggtggcggtgccgctcatgccgccccggcgcaacgcaaatcaggat
tccagcgccgccatcatcgcagattgcgcccccgtgctcgcgctcagcccggcgggcgag
gcggaagacccgcgcggcacgctgcgccagcgcctcgcggacggcaatgtccggcatttg
ccggtcgcgctcgcggacaatgcgaccgacgatctgcccgctcgcgccatcgcccggcag
gatctggccttcctgcaatatacgtccggctccacctccacccccaagggcgtgatggtg
agccacgccaacctgctggccaatctggaaatgatgcgccagcgcttcggcaatcacgcg
ggttcgacccatgtgagctggatcccgctctatcacgacctcgggctgatcctgaacctg
ctggagccgctgtatgtgggcgcgacgtgcgtgctcatgaccccctccggcttcatgcac
cgaccgctgaactggctgcgcaacattgcgcgcttcgaggccgaagtcgctgccgcgccc
aactttgcctaccacctctgcgtcgaccgcttccgggccgaccagatggagggcgtggac
ctcagccgctggacgctggcggtgaacggtgccgagccggtacgcgccgtgaccatggcg
cgctttgccgagaccttcgccccttacggcttcaacgcccgcacgctccatcccacctac
gggctggcggaagcgaccctcgtcgtgagttccgccccgcgcggcagcggggtaacggtg
cgcgaggtgagcgccgaagggctgaaggaccgtcgcatcgcgccgccgaaggacgcggaa
gaccgccagcccatcgtcggctgcggcctcaccatgccgggccagagcatcgccatcgtc
gatccgcagacccgccgccgcgccgagcccggtgccatcggcgagatctgggtgcatggg
gcgagcgtcgccggcggctactggaaccggccggaggagagcgaggcgaccttccgggcg
cacatcgaggacgagcccgacgccggccccttcctgcgcaccggcgacctcggacatctg
gatgcggatggcgaactcttcatcgccggccgcatcaaggacgtcatcatcatccgcggc
gtgaaccattatccgcaggacatcgagggcacggtggcggatgcccaccccaccctgcgc
cgggactatggcgcggtgttctgcgtcaccggcgaggacggcaccgagcaggtggtgctg
gtgcaggaggtggaacgcaccaagcgccatgccatcgacgagacggaagtcttcgccgcg
atccgggcggcggtggtcaacaatcacgaggtgaacgtggcgaagatcgtgctgatccgc
cccggcaccatccccaagaccaccagcggcaagatccagcgcagccgcacccgccagcag
tggctggacggcacgctggaggtgtgggatccccgcgcaccggaatcggcggccgaagcc
gtctga

DBGET integrated database retrieval system