KEGG   Azorhizobium caulinodans: AZC_4561Help
Entry
AZC_4561          CDS       T00609                                 

Definition
(GenBank) D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
azc  Azorhizobium caulinodans
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AZC_4561
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZC_4561
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AZC_4561
Enzymes [BR:azc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AZC_4561
Peptidoglycan biosynthesis and degradation proteins [BR:azc01011]
 Precursor biosynthesis
  Amino acid ligase
   AZC_4561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
5189748..5190668
Genome map
AA seq 306 aa AA seqDB search
MAKHVAVLMGGWSPEREVSLRSGAGCAKALEEVGYRVTRVDVDRDVAEVLARLKPDVALN
LLHGCPGEDGTIQGILEILRIPYSHSGVLASALAMDKARAKVVMAAAGIPVPGGHLVTRA
EAAKGHVLPPPYVLKPNTGGSSVGVFIVKEDQPHPPQELFRADWTFGESLMAEPFIKGLE
LTCGVMGDRALDVIEVEAVHGFYDYESKYAAGGSRHILPARVLPQIYQQVRMLALEAHRA
LGCRGISRADFRYDDTLPDGKGLVCLEVNTQPGMTETSLVPDMAAHAGISFGELVTWMVE
DATLDR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcatgtggctgtgctgatgggcggatggtctccggaacgggaggtctcgctc
cggtccggcgccggctgcgccaaggcgctggaagaggtcggctaccgcgtcacccgcgtg
gatgtggaccgcgacgtggccgaggtgctcgcccgcctcaagccggacgtggcgctgaac
ctgctgcacggttgccccggcgaggacgggaccatccagggcatcctcgaaatcctgcgc
attccctattcccattccggcgtgctcgcctccgcgctcgccatggacaaggcccgcgcc
aaggtggtgatggcggcggccggcattcccgtgcccggcggccatctcgtcacgcgggcc
gaggcggcgaagggccacgtcctgcccccgccttatgtgctcaagcccaataccggcggc
tccagcgtcggcgtcttcatcgtcaaggaagaccagccgcatccgccgcaggagctgttc
cgcgccgactggacgttcggcgaatcactgatggccgagcccttcatcaagggcctcgaa
ctcacctgcggcgtgatgggcgaccgcgcgctggacgtgatcgaggtggaagctgtgcac
ggcttctacgattatgaatccaaatacgccgccggcggctcccgccacatccttccggcg
cgcgttttaccccaaatttaccaacaggtccggatgctggcccttgaagcgcaccgcgcg
ctcggctgccgggggatctcccgtgctgacttccgctatgacgacacccttcccgatgga
aaggggctcgtgtgcctggaggtcaacacacagcccggcatgaccgagacgtctctggtg
ccggacatggcggcccatgcgggcatttccttcggcgagcttgtgacatggatggtcgag
gacgcgacgctggatcgctga

DBGET integrated database retrieval system