KEGG   Azoarcus sp. CIB: AzCIB_0790Help
Entry
AzCIB_0790        CDS       T04019                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
azi  Azoarcus sp. CIB
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:azi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AzCIB_0790
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AzCIB_0790
   00680 Methane metabolism
    AzCIB_0790
Enzymes [BR:azi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AzCIB_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(891438..894185)
Genome map
AA seq 915 aa AA seqDB search
MTQDKDAPLREDIRLLGRMLGDTVRDQQGEAVFGLIERIRQTSVRFRRDDDRAARQELEG
ILDALSREQTIQVARAFSYFSHLANIAEDQHHIRRSRAHLIAGSAPREGSLAHALARAFA
GGHEASALAAFFDTASISPVLTAHPTEVQRKSILNCETDIARLLDRRDRMVLTPEEREHS
EEAMRRAVLILWQTRMLRPAKLSVVDEVANGLSYFDATFLREVPRLYADLEDQLAKRDPA
LGALELPAFLRVGSWIGGDRDGNPFVTAEVLERALAMQSAAVLGFYLDELHTLGARLSLA
TGLVSASDGLLGLAERSPDLSPHRKDEPYRRAISGIYARLAATHRLLLGSEPPRHAVADA
EPYLTAYELSEDLDILHRSLVANGSAALARGRLRLLRRAVRVFGFHLAPIDLRQNSDVHE
RVVAELLATAQPGTDYRALDESGRCAALIAELSTPRLLASPHVRYSDETEGELAIFRAAR
RAHLRFGKEAITNCIISKTDDVSDLLELALLLKEAGLLRPHEQALDVNIIPLFETIEDLA
NAPTVMDRLFALPAYMSLLESRERMQEIMLGYSDSNKDGGFLTSGWSLYKAEIGLVEVFA
KHGVHLRLFHGRGGSVGRGGGPSYQAILAQPGGAVQGRIRLTEQGEVIAAKYNNPEVGRR
NLEVLVAATLEASLLSDNAPAPRAEFLDTMQALSDAAFAAYRGLVYETEGFERYFWESTV
ISEIAELNIGSRPASRKKGTRIEDLRAIPWVFSWAQCRLMLPGWFGFGAAVKAWRAAHPD
DGLARLQAMYKEWSFFATLLSNMDMVLAKSDLAIASRYAGLVKDPALRDAIFGRIRTEWQ
DTVDALLAITGQKELLDDNPLLKRSIRNRFPYLDPLNHVQVELLRRHRDGHDDARVRLGI
HISINGVAAGLRNSG
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggacaaggacgcaccactgcgcgaagacatccgactgctcggccgcatgctc
ggggacaccgtgcgcgaccagcagggcgaagccgtgttcggcctcatcgaacgcatccgc
cagacctcggtgcgcttccgccgcgacgacgaccgcgccgcgcgccaggaactcgaaggc
atcctcgatgcgctgtcgcgcgaacagacgatccaggtcgcgcgggcgttcagctatttc
tcgcacctcgccaacatcgccgaggaccagcatcacatccgccgcagccgcgcccacctc
atcgccggctctgcgccgcgcgaaggcagcctcgcgcatgcgctcgcgcgcgccttcgcc
gggggccacgaggcatcggcgctggcggcgttcttcgacaccgcttcgatctcgccggtg
ctcacggcccacccgaccgaagtccagaggaagagcatcctcaactgcgagaccgacatc
gcccgcctgctcgaccggcgcgaccgcatggtgctcacgcccgaggagcgcgagcacagc
gaggaagccatgcgccgcgccgtgctgatcctgtggcagacgcgcatgctgcgcccggcc
aagctgtcggtggtcgacgaggtcgccaacggcctgtcgtacttcgatgcgaccttcctg
cgcgaggtcccgcgcctctacgccgacctcgaagaccagctcgcgaagcgcgacccggcg
ctgggcgcgctcgaactgcccgccttcctgcgcgtgggcagctggatcggcggcgaccgc
gacggcaatcccttcgtcacggccgaggtgctcgaacgcgcgctcgcgatgcagtccgcc
gccgtactcggtttctacctcgacgagttgcacacgctgggcgcgcgcctgtcactcgca
actggcctcgtgagcgcctcggacggacttctcgggctcgcggagcgctcgcccgaccta
tctccgcaccgcaaggacgagccctaccggcgcgcgatctccggcatctacgcgcgcctc
gcggcgacccaccgcctgctgctcggcagcgaaccgccccgtcacgcggtcgcggacgcc
gagccctacctgaccgcgtacgaactgtccgaggatctcgacatcctccaccgctcgctc
gtcgccaacggctcggccgccctcgcgcgcggccgcctgcgcctgctgcgccgcgccgtg
cgcgtgttcggcttccacctcgcgccgatcgacctgcgccagaattcggacgtgcacgag
cgggtcgtcgccgagttgctggcgaccgcccagccgggcaccgattaccgtgcgctggac
gagtcgggccgctgcgcggccctcatcgccgaactgtccacgccgcggctgctcgcctcg
ccgcacgtgcgctactctgacgagaccgagggcgaactggcgatcttccgcgccgcccgc
cgcgcgcacctgcgcttcggcaaggaggcgatcacgaactgcatcatctccaagaccgac
gacgtctcggacctcctcgagctcgcgctgctgttgaaggaagcgggcctgctgcgcccg
cacgagcaggcgctcgacgtgaacatcatcccgctgttcgagaccatcgaggacctcgcg
aacgcgccgacggtcatggaccgcctgttcgcgttgccggcctacatgagcctgctggaa
tcgcgcgagcggatgcaggagatcatgctgggctactccgacagcaacaaggacggcggc
ttcctcacctccggctggtcgctgtacaaggccgagatcggactcgtcgaggtgtttgcc
aagcacggcgtgcacctgcgcctcttccacggccgcggcggctccgtcggccgcggcggc
ggcccgagctaccaggccatcctcgcgcagcccggcggcgccgtgcagggccgcatccgc
ctcaccgagcagggcgaggtcatcgcggcgaagtacaacaacccggaggtcggccgccgc
aacctcgaggtgctggtcgccgcgacgctggaagcgagcctgctgtccgacaacgccccc
gcgccgcgcgccgaattcctcgacaccatgcaggcgctgtcggacgcggccttcgccgcc
tatcgcggcctggtgtacgaaaccgagggcttcgagcgctacttctgggagtcgacggtg
atctccgagatcgccgagctcaacatcggctcgcgccccgcctcgcgcaagaagggcacg
cgcatcgaggacctgcgcgcgatcccgtgggtgttcagctgggcgcagtgccgcctgatg
ctgcccggctggttcggcttcggcgcggcggtgaaggcgtggcgcgcggcccatcccgac
gacggcctcgcacggctgcaggcgatgtacaaggagtggtcgttcttcgcgacgctgctg
tcgaacatggacatggtgctggcaaagtccgacctcgcgatcgcctcgcgctacgccggc
ctggtcaaggacccggcgctgcgcgacgcgatcttcggccgcatccgcaccgaatggcag
gacaccgtcgacgcgctgctcgccatcaccggccagaaggaactcctcgacgacaacccg
ctgctcaagcgctcgatccgcaaccgcttcccctatctcgatccgctcaaccacgtgcag
gtcgaactgctgcgccgccaccgcgacggccacgacgacgcgcgcgtgcggctgggcatc
cacatctcgatcaacggggtcgcggcgggcctgcgcaacagcggctga

DBGET integrated database retrieval system