KEGG   Azoarcus sp. CIB: AzCIB_3141Help
Entry
AzCIB_3141        CDS       T04019                                 

Definition
(GenBank) superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
azi  Azoarcus sp. CIB
Brite
Enzymes [BR:azi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AzCIB_3141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKU13034
UniProt: A0A0K1J8M6
LinkDB All DBs
Position
3512925..3513512
Genome map
AA seq 195 aa AA seqDB search
MEHTLPPLPYAKDALAPHISAETMEFHYGKHHQAYVTNLNNLIKGTEYENLDLEAIIKKA
PAGGVYNNSAQVWNHTFFWNGMKPNGGGEPTGALADAIKAKWGSFEDFKKAFTTSAVGNF
GSGWTWLVKKADGSVDIVNMGAAGTPLTTGDKALLCIDVWEHAYYIDYRNRRPDFVATFL
NSLANWDFAAKNFAA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggaacataccctgccccccctgccctacgccaaggacgccctggctccgcacatctcg
gccgagaccatggagttccactacggcaagcatcaccaggcctatgtgaccaacctgaac
aacctgatcaagggcaccgagtacgagaacctcgacctcgaggcgatcatcaagaaggcc
cccgccggcggcgtgtataacaactccgcccaggtgtggaaccataccttcttctggaac
ggcatgaagccgaacggcggcggcgagccgaccggcgcgctggccgacgcgatcaaggcc
aagtggggcagcttcgaggacttcaagaaggccttcacgacctcggccgtgggcaacttc
ggttcgggctggacttggctggtgaagaaggccgacggcagcgtcgacatcgtcaatatg
ggcgcggccggcaccccgctgacgaccggcgacaaggcccttctctgtatcgacgtgtgg
gaacacgcctactacatcgactatcgcaaccgtcgcccggacttcgtcgcgaccttcctg
aacagcctcgccaactgggacttcgccgcgaaaaacttcgccgcctga

DBGET integrated database retrieval system