KEGG   Azospirillum sp. B510: AZL_005650Help
Entry
AZL_005650        CDS       T01169                                 

Gene name
tufA
Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  
elongation factor Tu
Organism
azl  Azospirillum sp. B510
Brite
Translation factors [BR:azl03012]
 Eukaryotic Type
  Elongation factors
   AZL_005650 (tufA)
 Prokaryotic Type
   AZL_005650 (tufA)
Mitochondrial biogenesis [BR:azl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AZL_005650 (tufA)
Exosome [BR:azl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AZL_005650 (tufA)
  Exosomal proteins of breast cancer cells
   AZL_005650 (tufA)
  Exosomal proteins of colorectal cancer cells
   AZL_005650 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
647329..648519
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNVGTIGHVDHGKTSLTAAITKVLAESGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDPELLELVELEVRELLSSYQFPGDDIPITKGSALCALE
DRQPEIGRDAVLALMQTVDEYIPQPERPKDRPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGDEVEIVGLKATVKTTVTGVEMFRKLLDSGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGMVSLPEGVEMVMPGDNVA
MEVALIAPIAMDEGLRFAIREGGRTVGAGVVAKIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcaaagtttgagcggaacaagccgcactgcaacgttggcacgatcggccac
gtcgaccacggcaagacgtcgctgacggcggcgatcacgaaggtgctggcggagtccggc
ggcgcgaccttcaccgcttacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgacggcccatgtcgagtacgagacgaccaaccgccactacgcgcacgtc
gactgcccgggccacgccgactatgtgaagaacatgatcaccggcgccgcccagatggac
ggcgcgatcctggtggtgtcggccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctggctcgccaggtcggcgttccggcgctggtcgtgttcatgaacaaggtcgacatg
gtcgacgatccggagctgctggagctggtcgagcttgaggttcgcgagctgctgtcgtcc
taccagttccccggcgacgacattccgatcaccaagggttcggccctgtgcgccctcgag
gaccgtcagccggagatcggccgtgacgccgttctggcgctgatgcagacggttgacgag
tacatcccgcagccggagcgtccgaaggaccgtccgttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcaccgttgtgaccggccgcgtcgagcgtggcatcgtgaag
gtcggtgacgaagtcgagatcgtcggcctgaaggcgacggtgaagacgacggtgaccggc
gtcgagatgttccgcaagctgctcgactcgggcgaggccggcgacaacatcggcgcgctg
ctgcgcggcaccaagcgcgaggacgtcgagcgcggccaggttctggccaagccgggttcg
atcaccccgcacaccaagttcaaggccgaagcctacatcctgacgaaggaagagggcggc
cgtcacaccccgttcttcaccaactaccgtccgcagttctacttccgcacgacggacgtg
accggcatggtctcgctgccggaaggtgtggagatggtgatgccgggcgacaacgtcgcc
atggaagtcgcgctgatcgcaccgatcgccatggacgagggcctgcgcttcgccatccgc
gagggtggccgcaccgtcggcgccggcgtcgttgccaagatcgtcgagtga

DBGET integrated database retrieval system