KEGG   Azospirillum sp. B510: AZL_f00750Help
Entry
AZL_f00750        CDS       T01169                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
pAB510f:complement(88162..96645)
Genome map
AA seq 2827 aa AA seqDB search
MCRCTEQVREAGVDGGPATLAGLIGLRTEINAQDTAFTFLSDHGETAVTWAELAARAGRI
AAQLRANGLNGRRALLLASPGAGFVAGLYGCLLAGTVAVPCHSRVGGNHGDRVNQLAEDA
ALGGVLAETAVIGHLDQHDERLPALRGLPRLPLDSDDFVEDSGAGAGHWEPPPIIDPAAP
AIIQFTSGSTGRPRGVVLTHRNLLDNLAHSSRLFGLSGRSVGVSWLPPYHDMGLIGGILS
PLYAGFPAFILPPTHFLGRPLDWLRVIARTGATISGAPNFAYDLCVEKATDEDIEALDLS
HWEVAFCGAEPIFPDTLDRFARRFARAGFDPSAFRACYGLAEATLFVSGSPGRPKARSFA
TDALQRFRVEPVASDGQTLVGHGHPPPGIDIAIVDPVERRRCEADEVGEIWVRGASVSNG
YWQREMETGDVFQGVLQEAGEGGFLRTGDLGFVFDGDLFITGRSKDLIIVAGANHAPQNL
ERIAETCHPALRASGCAAFSVPDEAARCERIVIVQEVLRRHRHGDLRAIADAIRQSVLSA
QGLQADWVVLIPHGALPRTSSGKVRRRACRDAFLDGTLTRRALAVVSSALEAGGAAAQGA
DIPADGHERRHLVRIYLEEQIARAMGRDGTIDGSVPLAFLGIDSLSGAVLLGGLEARFGV
RGSLQQLLESSLTDLVDRIAADAPNGERGRSAEAVPGAGSRDDGLSFVQKGLWYLHAGHP
ESSESILALAWRLPARTETADVEKACRDLLERHPLLRAVFPAMDDGGQRRIVRDEPVFAF
RRHDGTGSGNALAVALNREAWRPFDLTHGPLIRFDLFAGDGDRMVLLVSVHHIICDYWSL
SLLFEELATAIAAPGAVIPAPDRSFADYVVQQRAMLAGPDGERLRAYWTGVLRDLPPLAR
LEAGSRRMTQAGGSSLEFSIPAAVLTVLKALADSRRVSLFTVLLAAFNVVAQRFLAEDDF
VVGSAVAARPSPDWGRTVGPLVNLLPLAARIRGDAPFPAVLERTWDVVLGALDHKDYPFA
LMVEQHRGARPESGNPFFAIVFNLLSASVPFSRGFDALSAEPIPLTKPDSQFDLMLSVTE
REDGLACLIEYDRSAVGDETVSAMAAHYRLLAEEIARDPERRVSEFPVPEDGLGQAAGRN
GGVLRGGDGVCWVRDLFEAAVRRTPDAIAVRSGGEALTYAQLDARANRLADHLRARGAFP
DRFVGVALERSCAIAVALLAVNKAGAAYVPLDPTHPPERNARILAECGAGILITQDRLAP
TFRGTAPELVVIDRGPPGVENRPDSDPELCVRPDHRVPDHIAYVLFTSGSTGQPKGVMVT
QRGLTNMLQSMVGKTGITAEDRLAAVTTFSFDMAQVELFLPLIVGGSVDILPACETNHGE
ALRDALTRATVMQATPATWQMLTEAGWREGRHLTVITGGEALNEQLAQRMLETGARVLNY
YGPTETAVYSTGQLIDRADDIAIGGPIADTQVYVLDAWMRPRPAGLSGELYIGGAGLARG
YLGRPDLTAERFIPDPFGPAGGRLYRTGDRVRFRPDGNLDYLGRLDRQVKIRGHRIEPGE
VEAVLRRHPVVEDALVVPRASVSGDTVLTAYVILRSAFRPSSDADARHRIEVLKEHLAAA
LPRIMVPRDLVFLDAMPRLSNGKIDRKALPVPDPLLAGTSDAAPATPTEYAVARIWADLL
GAGAIGRDDDFFALGGHSLLGMRLSAAIHKAFGVELRQTVLFHKSTLRQLSADIDRLLER
RVEPDAPPPANAAVFQEPLPLTAPQQRVWYLESLMPGTPALNSVFCARIWGTLDVGRLRA
ALGALVRRHPILRSTFRVIDGEPRREVHERLAPDAQVVEWPNDADSRDAQAFAHFDDAIH
RPFDLGTGPLLRLFVYPGPSDLILGLVTHHLIADGLSLDIAMGELSVLYNGLAAADAWAE
AVPSPATDGGSEAVHVARHKDARLEDGLRYWREALTGLSPLNLPPDFPRPPVLSWNGDWR
ELRLGQARSERLRRFAAIERKTPFMVLLAALNIELARLCDQPDIIVGTAVANREGPEVFE
AIGNFVNMLALRTHVDGGATFRDVLERTRATCLEAFRHQHVPFEQVVAEVKADRHLAHSV
LLPVLFVLQPPRSRQDFAGMPVEVVERGLRAARADLEIHFWDEPEFIGRVVYSTDLFAPE
TVERFIDRFLALLDHMMDDPERSLAAGLPLAADDRRLIGRFRCAEAALPTPFEPVHAMIQ
RQAERQPDAVAVRCGGRMLTYRQLDKDAGRLSRRLRRLGVGPEVRAGVLLPRSVDAVIAI
LAVLKAGGAYVPLDPLHPPQRLNAILRSSDAAAVITTGELADVLAETGPAAILIDGGQDG
EEDGEAQRPATVDSGHLAYVIHTSGSTGVPKGVQITHGALANLVMSMRHLIGIGAGDVQT
SQASFAFDASVAEIFPPLAAGATLALLPESALADGHSMRTAILDAGATVVQATATQWRML
LEAGGFGNRQIKALFGAEPADPQLVAAITATHDRVWHMYGPTETTVWSAAQVVSAGMSLS
LGEPLAGTDLHILDDHGNPVPIGVEGELCIGGIGLARGYLNAPAETALRFMPDPFCGRPG
ARLYRTGDRARMLASGDVVLCGRTDHQIKLRGFRIEAGEVEAALLRHTEIAVAAVTVNHR
PGQADRLVAHVQTAAGCGLPPPEVLRHSLGRVLPHYMIPSLFIPVERMPRTATGKLDRKA
LPAVEDTRPSLGEEFTAPRTEEERKIAEIWRNVLSIDRVGIYDNFFALGGDSMRALRVIY
ESRAIGLDITLQYLLSNPTVFALAQNLPEAPALEGMPEGGEETVPFALLSVEDRARLRTL
QSRAGER
NT seq 8484 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcggtgtacggaacaggtgcgtgaggctggcgtggacggcggaccggcgaccttg
gccggtctcatcggcctgcgcacggaaatcaacgcgcaggataccgcgttcacattcctg
tcggatcatggtgaaaccgccgtgacctgggccgaacttgcggccagggccgggcgaatc
gccgcacagcttcgggcaaacggtctgaacggcaggagggcgctgctgctggcctccccc
ggtgccgggttcgtggctggactttacggctgcctgctggcggggaccgtcgccgtgccc
tgccattcccgcgtcggcggaaaccacggggaccgtgtgaaccagctggccgaggacgcg
gctctgggcggcgtcctcgccgaaaccgcggtgatcggtcacctcgaccaacacgatgag
cgactgccggccctgcgcggcctgccccggctgcccttggacagtgacgacttcgtcgaa
gactccggggccggtgcgggacactgggagccgccgcccatcatcgacccggcggcaccg
gcgatcatccagttcacgtcgggttcgaccgggcggccccgcggagtagtgctgacccat
cgcaatctgctggacaacctggctcacagcagccgcctgttcggtctgtccggccgaagc
gtcggggtcagttggctgcccccctaccatgacatgggcctgatcgggggcattctgtcg
ccgctctacgccggatttccggcgtttatcctgccgcccacccatttcctgggccggccc
ctggactggctgcgggtcatcgcgcgaacgggggcaaccatcagcggcgctcccaatttt
gcctacgatctttgcgtggaaaaggccacggacgaagacatcgaagccctggacctcagc
cactgggaggtggccttctgcggtgccgagccgatttttcccgacacgctcgaccgcttc
gcccgccgcttcgcccgcgccggtttcgacccgtccgcctttcgcgcctgctacgggctg
gcggaagcgacgcttttcgttagcggctcgccggggcggccgaaagcgcggtccttcgct
accgacgccttgcaaaggttccgcgtcgagccggtggcatcggatgggcagaccttggtc
gggcatgggcacccgccaccgggcatcgacatcgcgatcgtcgatcccgtggaacgcagg
cgctgcgaggcggatgaggtcggtgaaatctgggttcgcggtgccagcgtctccaacgga
tactggcagcgggagatggaaaccggcgacgtctttcaaggggtgcttcaggaagcaggg
gagggggggtttctgcgaactggcgacctggggttcgtgttcgacggcgatctgttcatc
accgggcggtccaaggatctgatcatcgtcgcgggggcgaatcacgcgcctcagaatctg
gagcggatcgccgaaacttgccaccctgcgctccgtgcctctggctgtgcggcattttcg
gtgccggacgaggccgcgcgctgcgaacggatcgttatcgtgcaggaagtgctacgccgg
caccggcatggcgaccttcgggccattgccgacgcgatacgccagtccgtgctgtcggct
caagggctacaggccgattgggtggttctcattccccacggcgccctgcccagaacatcg
agcggcaaggtgcggcgccgtgcgtgccgcgacgcctttctggacggtacccttacgcgc
cgtgcactggccgtcgtttcgtccgctttggaagcagggggcgccgcagcgcaaggcgcg
gacatccccgcggacggccatgaacggcggcatctggtgcggatctatctggaggagcag
atcgcgcgagccatgggacgggacgggaccatcgacggttcggtgccgcttgcctttctc
ggcatcgattccctctcgggagccgtccttctcggcggtctcgaagcccgattcggcgtt
agaggcagtctacagcaactgctcgaaagcagcctgacggatctggtggaccggatcgcc
gccgacgcaccgaacggtgagcgtggccggtcggcggaggcggtccccggcgccggaagc
cgggacgacgggctttcctttgtccagaaagggctgtggtaccttcatgcagggcatccc
gagagctccgaatcgatcctggccttggcttggcgcctgcccgccaggacggagaccgcc
gacgtcgagaaagcctgccgcgatcttctggagcgtcatcctctgctgcgggctgtgttc
ccggcgatggacgacggcggtcagcgccggatcgtccgggacgaaccggtgttcgcgttc
cgccgtcacgacgggacgggtagcgggaacgccctggcggttgccctgaaccgggaggca
tggcggcccttcgatctgacccacggccccctgattcgcttcgatctattcgccggcgac
ggggaccggatggtgctgctggtcagcgtccatcacatcatttgcgattattggtcgctt
tcgctgctgttcgaggaactggccacggcgatcgccgcccccggtgcggtgatcccggct
ccggaccggagctttgccgattacgtcgtccagcagagggctatgcttgccggtcccgat
ggcgaacggctccgcgcctattggacgggggtgttgcgcgacctgccgccgctggccagg
ctggaagccggctcccgccggatgacgcaggccggcgggagttctctggaattctccatt
cccgctgccgtgctcacggtgctgaaggcactggcggactcccgtcgggtgtccctattc
acggttctcctggccgctttcaacgtggtggcccagcggtttctggcggaagatgatttc
gtcgtcggctccgcggtcgcggcccgtccgtccccggactgggggcgcaccgtcggtccc
ctggtcaatctgctgcccttggccgcccggatccgcggcgacgcgccgttcccggccgtg
ctcgaacgcacgtgggacgtggttctgggggcactcgaccacaaggactatcccttcgcc
ctgatggtcgagcagcaccgcggggcgcggccggaatcgggcaatccgttcttcgccatc
gtcttcaatctgctgagcgccagcgtccccttcagccgcgggttcgatgccttgtctgcc
gaaccgatccccctgaccaagcccgacagccagttcgatctgatgctctcggtcacggaa
cgcgaggatgggctggcctgcctcatcgaatacgaccgcagcgcggtcggcgacgagacc
gtgtccgccatggcggcccattaccggttgttggccgaggaaatcgcccgtgaccccgag
cggcgggtgtctgaattcccggtccccgaagacgggctgggccaggcggcgggacggaac
ggcggtgttctacgcggcggggatggggtctgctgggtccgggatctgttcgaagctgcc
gtccggcgcacgcccgacgccatcgcggtgcgcagcggtggcgaagcactcacttatgcg
cagcttgacgcgcgggcaaaccggcttgccgatcacttgcgcgcacgtggggcgttcccg
gaccgcttcgtgggggtggcgctggaacggtcgtgcgccatagcggtggcgcttctcgcg
gtcaacaaggccggtgctgcctatgtccccctcgacccgacccatccgccggaaaggaac
gcccgcatcctggcggagtgcggagccggaatcctcatcacccaggaccgtctggcgccg
actttcaggggcaccgccccggaactggtggtgatcgaccgcggcccgccgggggtggag
aaccggcccgatagcgatccggaactgtgcgtccgtccggatcatcgtgtgccggatcac
atcgcttatgtgctgttcacctccggctccaccggacagcccaaaggggtgatggtcacc
cagcgcggcctgaccaacatgctgcaatcgatggtcgggaagaccggcattacggcagag
gaccgtctggcggccgtcacgacgttttcgttcgacatggcgcaggtggagctgttcctg
cccctgatcgtcggcggcagtgtcgacatcctgcccgcctgcgaaaccaaccacggtgag
gcgctgcgggacgcgctgacccgcgcgaccgtcatgcaggcgaccccagcgacgtggcaa
atgctcaccgaggccggatggcgggaggggcggcatctgaccgttatcaccggaggcgag
gcgctgaacgagcagctggcccaacgcatgctggaaaccggcgccagagtgttgaactat
tacggcccgacggaaacggcggtgtattcgaccggacagctgatcgatcgggccgacgac
atcgccatcggcgggccgatcgccgacacccaggtctatgtgctggacgcgtggatgcgg
ccccggcccgccggcttgtcgggcgagctttatatcggcggggcggggctggcgcgcggc
tatctgggccggcccgatctgaccgccgaacggttcatcccggacccgttcggcccggcc
ggggggcggctttaccgcaccggcgacagggtgcgtttcaggccggacgggaacctcgac
tatctgggccggctggaccgccaggtgaagatccgcgggcaccgcatcgagccgggagag
gtggaggctgtcctgcgccggcacccagtggtcgaagacgctctggtggtgccgcgggcg
tccgtatccggcgacacggtgctgacggcctacgtcattctccggtccgcctttcggcca
tcctccgacgcggacgcccggcaccggatcgaggtcctgaaagagcatctcgccgcagca
ctgccccgcatcatggtgccgcgggatctggtcttcctcgatgcgatgccgcgcctgtcc
aatggcaagatcgaccgcaaggcgcttcccgtccccgacccgctgctggcggggaccagc
gacgccgcccccgccacgccgaccgaatatgcggtcgcgcggatctgggcagacctgctg
ggggccggcgcgatcgggcgggacgacgacttcttcgccctgggaggccactcgctgctc
gggatgcggctgtccgccgcgatccacaaggcgttcggcgtcgaactgcgccagacggta
ttgttccacaagtccacattgcgtcagctttcggcggacatcgaccggctgctggaacgg
cgggtcgagccggatgcaccgcccccggcgaacgcggcggtgttccaggagcctcttccg
ctcaccgcaccgcagcagcgggtctggtatctggaaagcctcatgccagggaccccggca
ctgaacagcgtcttttgcgcccgcatctgggggacgcttgatgtcgggcggctgcgtgcg
gcgctgggagccttggtgcgccgccatccgatcctgcgctcgactttccgggtcatcgac
ggcgaacctcgccgggaggtgcatgagcggctcgcccccgatgcccaagtcgtcgaatgg
ccaaacgacgccgacagccgcgacgctcaggcttttgcccatttcgatgacgcgatccac
cggcccttcgacctggggaccggtcccctgctgcggctgttcgtctatcccggaccatcg
gacctgatcctcgggctggtgacccaccacctgatcgccgacgggctgtcgctcgacatc
gccatgggcgagttgtccgtcctctacaacggcctggctgccgcggacgcttgggcggag
gccgtgccgtctccggccacggacggcgggagcgaggccgtgcatgttgcccgacacaag
gatgcacggctcgaggacgggctgcgttactggcgcgaggcgctgaccggtctgtcgccg
ctcaacctgccccccgatttcccgcgtccgcccgtcttgtcctggaacggggattggcgc
gaactgcgtctcggtcaggcccggtcggagcggttgcgtcgtttcgccgccatcgagcgc
aagaccccgttcatggtcctcctggccgcgttgaacatcgaattggcccgcctgtgcgat
cagccggacataatcgtcggcacggccgtcgccaaccgggaagggccagaggtgtttgag
gccatcggcaatttcgtcaacatgctggccttgcgcacccacgtggacggcggcgcaacg
ttccgcgacgttctggagcggacccgtgccacctgcctggaggcgttccgccatcagcac
gtccccttcgaacaggtggtcgccgaggtgaaggccgaccgccaccttgctcatagcgtg
cttctgcccgtcctgttcgtgcttcagccgccacgcagccggcaggatttcgccgggatg
cccgtggaggtggtggagcgcggactgagggcggctcgcgccgatctggagattcatttc
tgggacgagccggagttcatcgggcgcgtcgtctacagcacggatcttttcgcccccgaa
accgtcgagcggttcatcgaccggttcctggcactgctcgaccacatgatggacgacccc
gaacggagcctcgccgccggcctgccgctggcggcggacgaccggcggctgatcgggcgc
ttccggtgtgccgaagccgcactcccgacaccgttcgagcccgtccacgccatgatccag
cggcaggccgagcgacagccggacgccgttgccgtgcgctgtggcggccggatgctcacc
taccgccaattggacaaggacgccgggcggctgagccggcgcctgcgacggctgggggtc
ggtcccgaggtccgggccggggttctgctgccgcggtccgtcgatgcggttatcgccatt
ctagcggttctgaaggcgggcggcgcctatgtgccgctcgatccgcttcacccgccccag
cgcctcaatgccatcctgcggtcgtccgatgcggcggcggtgatcaccaccggggaactg
gccgacgttctggcggaaactggcccggccgccatcctgatcgacggaggacaggacggg
gaagaggacggtgaggcgcaacggccggcgacggtcgattccggccatctggcatacgtc
atccacacctccggctccaccggcgtgccgaagggcgtgcaaatcacccatggggcgctg
gccaatttggtcatgtcgatgcggcatctgatcggcatcggggccggcgatgtccagaca
tcgcaggcgagcttcgccttcgacgcttcggtcgcggagatctttccgccgctggccgcc
ggggcgaccctggccctcctgccggagtccgccttggcggacggacacagcatgaggacg
gcgatcctggatgccggagccaccgtggttcaggccaccgcgacccagtggcggatgctg
ctcgaagcgggcggtttcggcaaccggcagatcaaggctttgttcggggcagaaccggcc
gatccgcagctcgttgccgcgatcaccgccactcacgaccgggtgtggcatatgtacggc
ccaaccgagacgacggtctggtcggcggcccaggtggtgtcggcgggcatgtcgctctcg
cttggggaaccgctggccggcactgacctccacatccttgacgaccatgggaacccggtg
cccatcggcgtggaaggggaactgtgcatcggcggcatcgggctggcgcggggatacctg
aacgccccggcggaaaccgccctccgcttcatgcccgacccgttctgcggccggcccggc
gctcgcctctaccgcaccggggaccgcgcccggatgctcgccagcggcgatgtcgtgctg
tgcggccgcacggatcaccagatcaagctgcgaggcttccggatcgaagcgggcgaggtc
gaagccgcgctgctccggcacaccgaaatcgctgtcgctgccgtcacggtgaaccaccgg
cccggccaagccgaccgcctcgtcgcccatgtccaaacggcggcggggtgcggcctgccg
ccgccggaagtgctgcggcacagcttgggccgggtactgccccattacatgatcccgtca
ctcttcatccccgtcgaacggatgccgcggaccgccaccggtaagctggaccgcaaggcg
ctgccggccgtcgaggatacgcggccttcccttggagaagaattcacggcaccacgcacc
gaagaagaacggaagattgccgagatatggcgcaatgttctatcgatcgatagggttggt
atctatgataacttcttcgcacttggaggagactccatgagggcgctgagggttatttac
gagtcccgtgccattgggctggacatcacgcttcaatatttgctgagcaacccgacagtc
ttcgccctggcccagaacctcccggaggctccggcattggaggggatgccagaggggggg
gaagagacggttccttttgccctgctgtcggtggaagaccgcgcccggctgcgcaccttg
cagtcccgtgcgggtgagaggtga

DBGET integrated database retrieval system