KEGG   Azoarcus sp. BH72: azo2750Help
Entry
azo2750           CDS       T00441                                 

Gene name
glpA
Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    azo2750 (glpA)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     azo2750 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(3031885..3033474)
Genome map
AA seq 529 aa AA seqDB search
MSGPPGQSRAALLARLRADPVWDVLVVGGGASGLGCAVDAAARGYQVALVEARDFAQGTS
SRSTKLIHGGVRYLAQGRLGLVREALHERARLLENAPHLVRPLRFVVPARRWSELATVGA
GLGLYDLLAGRGGIGRSRLLGAAETRAALPGVKADGLCGGVAYWDAQFDDARLALALART
LADLGGVPLNHCALERLLIEDGVIRGAVVRDTERAEPFALRARVVINATGVWSDQVRRLA
NPAAPATLRPSQGVHLVVDRAFLPGRQALLVPRTEDGRVLFMIPWQDRLLLGTTDTARAD
LPLEPEALPGEVDFILSTAARYLERAPGRADVLSVFAGLRPLLESAAARNSGELSREHVV
EVSAQGLVSMLGGKWTTYRSMAADAVDAAIEWAGLPARPCATASLRLHGAAAPRGDRLDA
YGSDLSGLESLPGAGRVLVEGLDLTEAEVRHAARAEWARGVEDVLARRHRALFLDATLAA
CAAPAVAQILAAELGRDEGWVAAQTDAFHALASAYGASLSRACAAARSG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggccacccgggcagtcccgcgccgccttgctggcgcggctgcgcgcagacccc
gtctgggacgtgctcgtggtcggcggcggcgcaagcggcttggggtgcgcggtggatgcg
gccgcgcgcggctaccaggttgcgctggtcgaggcgcgcgatttcgcccagggaacgagt
tcgcgctccaccaagctcattcacggcggcgtgcgttatctcgcccagggaaggctgggg
ctggtgcgcgaggcgctgcatgaacgtgcgcggctgctggagaacgccccgcatctggtg
cgtccgctgcgcttcgtcgttccggcacggcgctggtcggagctggcgaccgtgggcgcc
ggtcttggcctttacgacctgctcgccgggcgcggcggcatcgggcgcagccgtctgctc
ggtgcggcggaaacccgcgccgcgctgcccggcgtgaaagccgacgggttgtgcggcggc
gtggcctactgggacgcgcagttcgatgacgcccgcctcgcgctcgccttggcgcgcacc
cttgccgatctgggcggcgtgccgctcaaccactgtgcgctcgaacgcctgctgatcgag
gacggcgtgatccggggcgccgtggtgcgcgacacggagcgcgcggaaccctttgcgctg
cgcgcgcgggtggtgatcaacgccaccggcgtgtggagcgaccaggtgcgccggctcgcc
aaccccgcggcgccggccacgctgcgtcccagccagggcgtgcatctggtggtggatcgc
gccttcctgcctggccggcaggcgctgctggtgccgcgcaccgaggatggccgcgtgctg
ttcatgattccctggcaggaccggctgctgctcggcaccaccgacaccgcgagggccgac
cttccgctcgaaccagaggcgctgcccggggaggtggatttcatcctgtcgaccgcggca
cgctatctcgaacgcgctcccgggcgtgccgacgtgctcagcgtgttcgccggcctgcgc
cccttgcttgaaagcgccgccgcgcgcaacagcggcgagctgtcgcgcgagcacgtcgtg
gaggtctctgcgcaggggctggtgagcatgctgggcggcaagtggacgacgtaccgcagc
atggcggcagacgcggtggatgcggcgatcgagtgggcgggtttgccggcgcggccgtgc
gctaccgccagcctgcgtctgcacggggcagcggcgccgcgcggggatcggctggatgcg
tatggaagcgacctgagcgggctcgaatcactgccgggcgcgggccgggtgctggtcgaa
gggctggacctgaccgaagccgaggtccgccatgccgcccgtgcggagtgggcgcgcggc
gtggaggacgtgctcgcgcggcgccaccgcgccttgttcctggatgcgacgctggccgcg
tgcgccgcgccggcggtggcgcagatacttgccgccgaactgggccgggatgagggctgg
gtggctgcgcagaccgacgcatttcacgcgttggccagcgcctacggcgcgtccctcagc
cgagcttgtgctgcagcacgtagcgggtga

DBGET integrated database retrieval system