KEGG   Brucella abortus A13334: BAA13334_I00498Help
Entry
BAA13334_I00498   CDS       T01704                                 

Definition
(GenBank) Enoyl-acyl-carrier-protein
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
baa  Brucella abortus A13334
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BAA13334_I00498
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAA13334_I00498
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    BAA13334_I00498
Enzymes [BR:baa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BAA13334_I00498
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BAA13334_I00498
Lipid biosynthesis proteins [BR:baa01004]
 Fatty acid synthase
  Component type
   BAA13334_I00498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1:306102..306920
Genome map
AA seq 272 aa AA seqDB search
MEGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDF
VLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVI
SAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGP
QGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSG
VTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttgatgcaaggaaaacgcggcctcatcatgggggtcgcgaacaatcactca
ctggcctggggcattgcaaaacagctcgccgcacagggcgccgaactggccttcacctat
cagggtgatgcgctgggcaagcgcgtgaaacctcttgccgaacaggtcggctcggatttc
gtgctgccttgcgacgtggaggacatcgccaccgtcgatgccgttttcgaagaaatcgag
aagaagtggggcggtctcgatttcctcgtgcacgctatcggtttttccgacaagacggaa
ttgaagggccgctatgcagatgtcaccacgcgcgagaatttcagccgcacgatggtcatc
tccgcctattccttcacagaagtggcgcagcgcgctgaaaagctcatgaaggacggcggc
tcgatcctgacgctgacctatggcggatcgacccgaacgatccccaattacaacgtgatg
ggtgttgccaaggccgctctcgaggccatggtgcgctatcttgcagccgattacggcccg
cagggcatccgcgtcaacgcgatttccgcaggccccgtgcgcacgcttgctggcgccggg
atcggtgatgcccgcgcgattttcagctaccagcgccgcaactcgccgctgcgccgcacc
gtcgatatcgatgatgtcggcaaatcggcagtctatcttctgtccgatctttcaagcggt
gtgaccggcgaaatccatttcgttgattccggctataacatcgtttcgatgccgacgctg
gaagagctgaaaagttcggactccgaacgcggagaataa

DBGET integrated database retrieval system