KEGG   Brucella abortus bv. 6 870: DO74_1875Help
Entry
DO74_1875         CDS       T03392                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
babr  Brucella abortus bv. 6 870
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:babr00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    DO74_1875
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DO74_1875
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    DO74_1875
Enzymes [BR:babr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DO74_1875
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DO74_1875
Lipid biosynthesis proteins [BR:babr01004]
 Fatty acid synthase
  Component type
   DO74_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1:1905497..1906315
Genome map
AA seq 272 aa AA seqDB search
MEGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDF
VLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVI
SAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGP
QGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSG
VTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttgatgcaaggaaaacgcggcctcatcatgggggtcgcgaacaatcactca
ctggcctggggcattgcaaaacagctcgccgcacagggcgccgaactggccttcacctat
cagggtgatgcgctgggcaagcgcgtgaaacctcttgccgaacaggtcggctcggatttc
gtgctgccttgcgacgtggaggacatcgccaccgtcgatgccgttttcgaagaaatcgag
aagaagtggggcggtctcgatttcctcgtgcacgctatcggtttttccgacaagacggaa
ttgaagggccgctatgcagatgtcaccacgcgcgagaatttcagccgcacgatggtcatc
tccgcctattccttcacagaagtggcgcagcgcgctgaaaagctcatgaaggacggcggc
tcgatcctgacgctgacctatggcggatcgacccgaacgatccccaattacaacgtgatg
ggtgttgccaaggccgctctcgaggccatggtgcgctatcttgcagccgattacggcccg
cagggcatccgcgtcaacgcgatttccgcaggccccgtgcgcacgcttgctggcgccggg
atcggtgatgcccgcgcgattttcagctaccagcgccgcaactcgccgctgcgccgcacc
gtcgatatcgatgatgtcggcaaatcggcagtctatcttctgtccgatctttcaagcggt
gtgaccggcgaaatccatttcgttgattccggctataacatcgtttcgatgccgacgctg
gaagagctgaaaagttcggactccgaacgcggagaataa

DBGET integrated database retrieval system