KEGG   Brucella abortus 63 75: DK49_2424Help
Entry
DK49_2424         CDS       T03461                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
babt  Brucella abortus 63 75
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:babt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DK49_2424 (glsA)
   00220 Arginine biosynthesis
    DK49_2424 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DK49_2424 (glsA)
Enzymes [BR:babt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     DK49_2424 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:352602..353555
Genome map
AA seq 317 aa AA seqDB search
MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGLAVVTADGQTFKTGDAD
IAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSVIALELHNGKSLSPLVNAG
AIATASLVPGDTADALWNNILECQCGFAGRRLKLSNEVNQSEQTTNFHNRAIAWLLYSAG
TCYSDPMEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPISGKRMVSAGNVAPILAEMT
MEGLYTALGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFSPPLDPAGNSVKAMAAVAAV
ADSLGHNLYTTRGKVSS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcatcagatgcgatcaaagccgctcttgagaagggacgcgcagcaggcctt
tctgcaaccggcggcaagaatgccgactatattccattcctggcgtcggttccgtccgac
ctgttcggtctggccgtggtgacggcggacggccagacttttaaaaccggcgatgccgat
atcgccttcgctatcgagtcgatttccaaggttttcacccttgccctggttatggaggag
attggtcccgatagtgtgcgggaaaaggtcggtgctgacccgaccgggctgccgttcaat
tctgtaatcgcgctcgaactccataacggcaagtcgctttcgccgctggtcaatgcaggc
gcaattgcaactgcaagccttgttcccggcgatacggcggatgccctctggaacaatatt
ctggaatgccagtgcggttttgcgggccgccggctcaagcttagcaacgaggtcaaccag
tccgaacagacgaccaattttcacaaccgcgccattgcctggctgctttacagtgccggt
acttgctacagcgatccgatggaggccgtggatatttatacgcgccaatgttcaacgctt
gtaaccgcgaccgaccttgccacgatgggggcaacccttgccgccggcggtgttaatccg
atcagcgggaagcgcatggtttcggcaggcaatgttgccccaattctggccgaaatgacc
atggaaggcctttatacggctttaggcgattgggcttatacggtcggcctacccggtaaa
agcggtgtcggtggtggcatcatggcggtagtgccgggtgagctggcaattgccgcgttt
tcaccgccgcttgatccagccggaaatagtgtgaaagcaatggctgctgttgccgcagtg
gcagattcacttggccataatctttataccaccagagggaaagtgtcatcctga

DBGET integrated database retrieval system