KEGG   Brucella abortus 63 75: DK49_838Help
Entry
DK49_838          CDS       T03461                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase family protein
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
babt  Brucella abortus 63 75
Pathway
babt00340  Histidine metabolism
babt01100  Metabolic pathways
babt01110  Biosynthesis of secondary metabolites
babt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:babt00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    DK49_838
Enzymes [BR:babt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     DK49_838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: AIJ79786
UniProt: A0A2K4NK14
LinkDB All DBs
Position
1:829354..829773
Genome map
AA seq 139 aa AA seqDB search
MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETG
IAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYR
QVVSSGGKVALTMASDHDQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttcctgcccagccttccgacaagaaggccgttgaagaaggcgcggcattc
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggcaagcgatcacgatcaataa

DBGET integrated database retrieval system