KEGG   Bacillus sp. 1NLA3E: B1NLA3E_04255Help
Entry
B1NLA3E_04255     CDS       T02643                                 

Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00473  D-Alanine metabolism
baci01100  Metabolic pathways
baci01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B1NLA3E_04255
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B1NLA3E_04255
Enzymes [BR:baci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B1NLA3E_04255
Peptidoglycan biosynthesis and degradation proteins [BR:baci01011]
 Precursor biosynthesis
  Racemase
   B1NLA3E_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Seadorna_Vp10
Motif
Other DBs
NCBI-ProteinID: AGK52627
UniProt: N0ARF7
LinkDB All DBs
Position
946847..948028
Genome map
AA seq 393 aa AA seqDB search
MSVQASYRDTWVEVSLDAIKHNIGQYKNLIGKSVNLMAVVKADGYGHGAAEVAETVLQAG
ADYLAVALLDEALQLRGVGISAPILVLGYTPIRSIKEAILFDIDLTVFTIDVLDEIIFQA
EQLQKPVSIHLKVDTGMSRIGVQSAEDALLLAEKAGASPFVFLKGIFTHFANADSVDQTY
TNKQYELFISVISYLNQHFIHIPLKHCCNTAATMKFPDKHLDMVRVGIGIYGLYPDPSLR
DHNINLKQAMSLKTKIASLKKVPISQPISYGCTSIPTQNSMIATLPIGYADGLSRLLSNK
GEFLLHCQKVQVTGRVCMDQTMVDVSDLIGCTQGDVVTIFGCDGDTFQSVDEIAKLMGTI
NYEVVCLIGKRVPRLYTSTERKTLCNSLVTSLF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgttcaagcaagttaccgagatacatgggtggaagtttccttagatgcaatcaag
cacaatataggacaatataaaaacctcatagggaaatcagtaaatttaatggccgtggtc
aaggcggacggatacggccatggtgcagccgaagtggctgaaacagttctacaagcaggt
gcagactacttagctgttgcgttattggatgaagcgttgcaattgcggggagtgggaatt
tcagctccgattcttgtgctaggatatacaccgattcgttcgataaaggaggcaatcttg
ttcgacatcgatttaactgtatttactatagatgttcttgatgaaatcatttttcaagct
gagcagcttcaaaagccggtttcgattcatttaaaagtagatactggtatgtcaagaatt
ggtgttcaatcagctgaagatgcattattactggctgaaaaggccggtgcttctccattt
gtctttctcaaagggatatttacccactttgccaatgctgatagcgtggatcaaacatat
acaaataagcaatatgagctgtttatttcagtgatttcttatttaaatcaacattttatt
catattccattgaaacattgctgtaatactgccgctacgatgaaatttcctgataaacat
ttagatatggtccgggtgggaataggtatttatggtctatatccagacccatctttgaga
gatcataatattaatctcaagcaggccatgtcattaaaaacgaaaatagcctcgctgaaa
aaggtaccaatatctcagccaatcagctatggctgtacaagtatcccaacacaaaacagc
atgatcgctacgttaccaattggatatgctgatgggctttctaggcttctttcaaacaaa
ggggaatttctactacattgtcaaaaagtccaggttacaggacgtgtctgtatggaccag
acaatggttgatgtttctgacctaattggttgcacacagggggatgttgtgactattttt
ggatgtgatggtgatacttttcaatcggtcgatgaaatcgccaaactgatggggacgatt
aattatgaggttgtttgtttaattggcaaacgagtcccacggctctacactagtacagaa
agaaaaactttgtgtaactcacttgtaacttctcttttttaa

DBGET integrated database retrieval system