KEGG   Bacillus sp. 1NLA3E: B1NLA3E_10160Help
Entry
B1NLA3E_10160     CDS       T02643                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B1NLA3E_10160
  Lipid metabolism
   00071 Fatty acid degradation
    B1NLA3E_10160
  Amino acid metabolism
   00350 Tyrosine metabolism
    B1NLA3E_10160
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B1NLA3E_10160
   00626 Naphthalene degradation
    B1NLA3E_10160
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B1NLA3E_10160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2227475..2228488)
Genome map
AA seq 337 aa AA seqDB search
MKAAVINEFHQQLEIKDVPVPELAYGEILVKIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVEAIAEGVSSIKVGDRVGVPWLYSACGECEYCLTGRETLCPDQINAGYSVDGGY
AEYCKAPANYVVKIPDGLDFHEVSPIFCAGVTTYKALKVSEAKPGDWVAIYGIGGLGHVA
LQYAKAMGFNVIAVDIQDDKLELAKQLGADISVNGLRVNPIEEIKAQVGGVQAAVSVAVT
KKAFEQAYGSVKRGGTLVVVGLPNADLPIPIFDTVLNGITVKGSIVGTRKDLQEAIEFAA
QGKVRTNIEVQPLNNINEVFDRMEKGYINGRVVLTLE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcagtaataaatgaatttcaccaacagttggaaattaaggatgtccccgta
cctgagttagcatatggggaaattcttgtaaaaatcaaagcatgcggagtctgccatact
gacctccacgctgcacatggggattggccagtgaaaccaaagcttcctctcatccctggt
catgagggagttgggatcgttgaagcaatagctgaaggtgtaagctctattaaagttgga
gaccgtgtcggtgttccatggctttattcagcctgtggtgagtgtgaatattgtctaact
ggccgtgaaacgttgtgcccagatcaaataaatgctggatattccgtcgatggaggctat
gcagaatattgtaaagcaccagctaactatgtagtgaaaattccagatggtcttgatttt
catgaagtttcaccaattttctgtgcgggtgtcactacctacaaggcattaaaggtatcg
gaggccaagcctggggattgggtggctatatatggaatcggcggcttaggacatgtggct
cttcaatatgcaaaagcaatgggtttcaacgttatcgctgttgatattcaagatgataag
ctagaattagccaaacaactaggggccgatatatcggtcaacgggttaagagtgaaccca
attgaggaaatcaaagcacaagtaggcggagttcaagcagcagttagtgttgctgttacg
aaaaaggcatttgaacaagcatacggctcagtaaaaagaggcggtacactagttgtagtt
ggccttccaaatgctgatttgccaattccaatttttgatacagttctaaatggtatcaca
gtgaaaggttctattgttggtactagaaaagatttacaggaagcgattgagtttgccgct
caaggaaaagttcgtacaaatatcgaagtccagccactaaataatattaatgaagtcttt
gatcgtatggaaaaaggatacattaacggacgggttgtattaactttggaataa

DBGET integrated database retrieval system