KEGG   Bacillus sp. 1NLA3E: B1NLA3E_18550Help
Entry
B1NLA3E_18550     CDS       T02643                                 

Definition
(GenBank) copper/zinc binding superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Brite
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B1NLA3E_18550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGK55454
UniProt: N0AWG7
LinkDB All DBs
Position
complement(4010438..4010995)
Genome map
AA seq 185 aa AA seqDB search
MAILNANCFLGMVHEMKRLLLLLPILLMTGCAEENPTKLDVEMFNSVGDSIGTIKLQEQS
SGVKMAIDLKGLQPGEHAIHIHDKGKCKGPDFQTAGNHLNPENKEHGLLHPKGPHAGDLP
NLIVDDEGKVSAELMAPQVTLKDGKNSLLTLNGTSIVIHEEKDDGMSQPSGDSGARIACG
KIPEK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcaatactaaacgcaaattgctttttggggatggtgcatgaaatgaaaaggctacta
ttgttacttccgattcttttaatgacgggttgtgcagaggagaacccaactaagctggat
gtcgaaatgtttaattcagtaggagattcaattgggacaataaaactccaggagcaatca
agtggcgttaagatggcaattgacttaaagggattacagccgggggagcatgccattcat
attcatgataagggtaaatgtaaaggaccggatttccaaacggcaggaaaccacttgaac
cccgaaaataaagaacacggcctgctccatccgaaaggaccacatgcaggtgatttgccc
aacttaattgtagacgatgaaggaaaagtaagtgctgaattaatggctccccaagtaact
ttaaaggatgggaaaaattctttattaactttgaatggaacttcgattgtcatccatgag
gaaaaagatgacggtatgagccagccttcaggtgactctggagcaagaatagcctgcggt
aaaattcctgaaaaataa

DBGET integrated database retrieval system