KEGG   Bacillus sp. BS34A: BS34A_12250Help
Entry
BS34A_12250       CDS       T03833                                 

Gene name
nprB
Definition
(GenBank) neutral protease B
  KO
K08777  
neutral peptidase B [EC:3.4.24.-]
Organism
bacl  Bacillus sp. BS34A
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:bacl00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BS34A_12250 (nprB)
Enzymes [BR:bacl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BS34A_12250 (nprB)
Peptidases [BR:bacl01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BS34A_12250 (nprB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:1186011..1187627
Genome map
AA seq 538 aa AA seqDB search
MRNLTKTSLLLAGLCTAAQMVFVTHASAEESIEYDHTYQTPSYIIEKSPQKPVQNTTQKE
SLFSYLDKHQTQFKLKGNANSHFRVSKTIKDPKTKQTFFKLTEVYKGIPIYGFEQAVAMK
ENKQVKSFFGKVHPQIKDVSVTPSISEKKAIHTARRELEASIGKIEYLDGEPKGELYIYP
HDGEYDLAYLVRLSTSEPEPGYWHYFIDAKNGKVIESFNAIHEAAGTGIGVSGDEKSFDV
TEQNGRFYLADETRGKGINTFDAKNLNETLFTLLSQLIGYTGKEIVSGTSVFNEPAAVDA
HANAQAVYDYYSKTFGRDSFDQNGARITSTVHVGKQWNNAAWNGVQMVYGDGDGSKFKPL
SGSLDIVAHEITHAVTQYSAGLLYQGEPGALNESISDIMGAMADRDDWEIGEDVYTPGIA
GDSLRSLEDPSKQGNPDHYSNRYTGTEDYGGVHINSSIHNKAAYLLAEGGVHHGVQVEGI
GREASEQIYYRALTYYVTASTDFSMMKQAAIEAANDLYGEGSKQSASVEKAYEAVGIL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaacttgaccaagacatctctattactggccggcttatgcacagcggcccaaatg
gtttttgtaacacatgcctcagctgaagaaagcatcgaatacgaccatacgtatcaaacc
ccttcatacatcatcgaaaagtcaccgcagaagccggtacaaaacacaacccagaaagaa
tcgctattttcctatcttgacaagcatcaaacgcagtttaagctcaaagggaatgcgaac
agccattttcgcgtttcgaaaaccataaaggatccaaagacaaaacaaacgttttttaaa
ttaacggaggtttacaaaggaattccgatttacggctttgaacaagcggtcgcgatgaag
gaaaacaaacaagtgaaaagtttctttggaaaggtgcatccgcaaatcaaggacgtctcc
gtcacaccgtctatttctgagaaaaaagcaatacatacagcaaggcgtgagctcgaggct
tccattggaaaaatcgaatatcttgatggggaaccaaaaggcgaattatatatctatcca
cacgacggtgaatatgatctcgcctaccttgtgagactctcgacatctgaacctgagcct
ggctattggcattatttcatcgatgccaaaaacggaaaggtcatcgagtcctttaatgcc
attcatgaagcggcaggtacaggaatcggcgtgtcaggtgatgaaaaaagctttgacgtc
acagaacaaaatgggcgcttttatttggctgacgaaacaaggggaaaagggatcaataca
tttgacgcgaagaacctgaacgaaaccttgtttacgcttttgtctcaactgatcgggtat
acgggcaaagaaatagtcagcggcacgtccgtatttaatgaacctgcggctgtagacgca
cacgcaaatgcgcaagccgtttacgattattacagcaagacatttggccgtgattctttt
gatcaaaacggagcaaggattacgtctaccgtgcatgtcggcaaacaatggaacaatgct
gcgtggaacggtgtccagatggtatacggggatggagacggttcgaaatttaagccgctg
tctggatcgctcgacattgtcgcgcatgaaatcacacacgcagtcacacagtattccgcc
ggtcttttatatcaaggagaacccggtgcattaaatgagtccatttctgacattatgggc
gcgatggctgaccgtgatgattgggagatcggcgaagatgtctatactcctggtattgca
ggagattcattgcggtcattggaggacccatctaagcagggaaatccagatcattactcg
aaccgctacacaggaacagaggattatggcggagtccatatcaattcgtccattcacaat
aaagcagcttatcttcttgcagaaggaggcgtgcaccacggtgtacaggttgaagggatt
gggcgtgaagcaagtgaacaaatttactatcgggctttaacatattatgtaacggcatct
acagatttcagcatgatgaagcaagcggcgattgaagctgccaatgatttatacggtgaa
ggctcgaagcaatcagcttcagtcgaaaaggcgtatgaggctgtcggcattctatga

DBGET integrated database retrieval system