KEGG   Bacillus sp. OxB-1: OXB_0866Help
Entry
OXB_0866          CDS       T03635                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
baco  Bacillus sp. OxB-1
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:baco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OXB_0866
Enzymes [BR:baco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     OXB_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(868931..870379)
Genome map
AA seq 482 aa AA seqDB search
MVQTYENLINGEWTNSVSGKLIESINPATREVMGKVQASTVEELQMAVQAANEAKKGWHK
LGQFQRGQLLYKVAEQLEKNLDDIAQTLTEEMGKTLPEAIGETQRGIAILKYYAAEGSRK
DGDVIPASDNGAIMFTKRTPLGTVGVITPWNFPVAIPIWKIAPALVYGNTVVFKPASEAA
VTAAKVVKCFADAGIPNGVLNFVTGSGSVVGDALIRSEGINGITFTGSSSVGRTVAEAAT
KNQVKFQLEMGGKNPVIVLNDANIDSAVQAILSGAFKSTGQKCTATSRVIVESGAYEVLK
QALIEESEKITIGSGLDAATWMGPCASESQYNTVLDYIEIGKKEGAKVLFGGNSLQSPSL
PGYYVEPTIFDQVDSSMRIAQEEIFGPVIALIKVESVEEAIQLANDVEFGLSASIFTTNI
GSALTFIDDIEAGLVRVNAESAGVEFQAPFGGVKSSSTGSREQGEAAKEFYTMTKTVFIK
AE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaacgtatgaaaacttaattaatggtgaatggactaatagtgtgagtggcaag
ttaatcgaaagtataaaccccgcaactcgcgaagtgatgggaaaagtacaggcttctaca
gttgaggaattacaaatggctgtacaagctgccaatgaagctaaaaaagggtggcataaa
ctcggtcaatttcaacggggacagttattatacaaggttgcagagcagttagaaaagaac
ttggacgatattgcgcaaacactgacagaggaaatgggtaaaacattaccagaagctatc
ggtgaaactcaacgtggaattgcgatcttaaaatattatgcagcagaaggaagccgaaag
gacggggatgtgatcccagcctcagataatggtgcaattatgtttacaaaacgcactccg
cttgggacagtaggcgtaatcacaccttggaacttccctgtagcaattcctatatggaaa
attgctcctgctttggtgtatggaaacacggttgtttttaagccagcttcggaggcggca
gtaacagcggccaaagttgtgaagtgcttcgcagatgcaggtattccaaacggcgtcttg
aattttgtgacaggaagtgggtctgttgtaggggatgcattaatccgcagcgaaggaatt
aacggcattaccttcacggggtcaagctctgtcggaagaactgtggcagaagctgcgact
aaaaatcaagtgaaattccaattagaaatgggcggaaaaaaccctgttatcgtattaaac
gatgcgaacatcgattcagctgtacaagctatactaagcggagcttttaagtcaactggc
caaaaatgtacagcaacgagtcgagtcatcgttgaatcgggggcatatgaagtattaaaa
caagcattgattgaggagtccgaaaaaattaccattggttctggcttagatgctgctacg
tggatgggaccatgtgcaagtgaaagtcaatacaatacagtattggattatattgaaatc
ggcaaaaaagagggagccaaggtgttatttggcggtaattcattacagtctccatcatta
ccgggctattatgtagagccaactattttcgatcaagtagattcatcaatgcgcattgcg
caagaggaaattttcgggccagtaatcgcattgattaaggtagaatcagtggaggaagcg
attcagcttgcaaatgacgtggagttcggattgagtgcttccatttttacaacgaatatt
gggtcagctttaacatttattgatgatattgaagctggattagtacgtgtaaatgcagaa
agtgcaggagtagaattccaagcacctttcggtggcgtcaaatcatccagcacaggtagc
cgcgaacaaggtgaagcagcaaaagaattttatacaatgacaaaaacagtatttatcaag
gctgaataa

DBGET integrated database retrieval system