KEGG   Bacillus sp. SDLI1: AUL54_07065Help
Entry
AUL54_07065       CDS       T05207                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00627  Aminobenzoate degradation
bacs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bacs00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AUL54_07065
Enzymes [BR:bacs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     AUL54_07065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AME06118
UniProt: A0A0X8KFJ2
LinkDB All DBs
Position
complement(1512966..1514423)
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLENRNPYTQKVITSFRKATPDDVDAAYRAAALAKQE
WDKVNPFKKRAILEKAVSFIEEHEEAIIYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIDGKENRLYRIPAGVVGVISPFNFPFFLSVKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAIKHFKKPLLELGGNSALIVLEDADLEYAVNAGVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLRRSVEKAIEEGAVPVLSGRFSG
TVAEPVILKDVKPEMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHTANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatgggagc
agccggaacgtattggaaaacaggaatccttatactcagaaagtcatcacctcattccga
aaagcgacgcctgatgacgtagatgcggcgtatcgcgccgcggctcttgcgaaacaagaa
tgggacaaagtcaatccttttaaaaagcgggccattttggaaaaagccgtatctttcatc
gaagagcacgaagaagcgatcatttacttaatcatggaggagcttggcggaacaaggctg
aaggctgagtttgaaatcggacttgtcaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtccacgattgacggaaaagaaaacaggctgtac
agaataccggccggcgtcgtcggggtcatcagcccgtttaacttcccgtttttcctttcg
gtgaaatcagttgcgccggcactcggagctggcaacggcgttgtgctgaagcctcatgaa
gaaacaccgatctgcggcggaacactgattgcgaagatttttgaagcggccggcgtaccg
gacgggctgctgaatgtcatcgtgacggatatcggggagatcggcgacagttttgttgag
catcccgtgccgcggattatctcatttacgggttcaaccggagtgggcagctatatcgga
cagcttgcgatcaaacacttcaaaaaaccgctgttggagcttggcggaaacagcgcgctg
atcgtgcttgaggacgctgatctcgaatacgccgtcaatgcgggtgtattcagccggttt
acgcatcaaggccagatctgcatgtcggcgaaccgggtgctcgtacacacatctgtatat
gacaaattcacagagctttacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgacacggtgatcgggcctttaatcaatgagaggcaggcggaaggtctgagacgg
tctgtcgaaaaagcgatagaagagggagcggttccggtgctgtccggccgattcagcgga
acggtcgctgagcccgtcattttaaaagatgtgaaacctgagatgagcatcgcgaaggag
gagctgttcggtccggccgtctgcatcatgccgtttgaaacggaggatgaagcggtaagc
atcgcaaacgcgacaccgttcggtttaagcggagccgtgcatacggcaaacgttgagcgc
ggcgttgagtttgctaagcggatcgaaaccggcatgattcacgtcaacgatacgactatt
aatgatgaaccgaatgtcgcgttcggcggcgagaagcaatcaggtctcggcaggctgaac
ggcgaatggagcctggaagaattcactacgctgaaatggatttcggttcagcatgaaaaa
cggcaattcccatattaa

DBGET integrated database retrieval system