KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015711Help
Entry
103015711         CDS       T03086                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Cell cycle
Longevity regulating pathway - multiple species
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Human papillomavirus infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    103015711 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    103015711 (HDAC2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    103015711 (HDAC2)
  Aging
   04213 Longevity regulating pathway - multiple species
    103015711 (HDAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103015711 (HDAC2)
   05202 Transcriptional misregulation in cancers
    103015711 (HDAC2)
   05203 Viral carcinogenesis
    103015711 (HDAC2)
   05220 Chronic myeloid leukemia
    103015711 (HDAC2)
  Neurodegenerative diseases
   05016 Huntington's disease
    103015711 (HDAC2)
  Substance dependence
   05034 Alcoholism
    103015711 (HDAC2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    103015711 (HDAC2)
   05165 Human papillomavirus infection
    103015711 (HDAC2)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103015711 (HDAC2)
Chromosome [BR:bacu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103015711 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     103015711 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103015711 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    103015711 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 492 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGN
QHFKGDLQSRGI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgctactactacgatggtgatatt
ggaaattattattatggacagggtcatcccatgaaacctcataggatccgcatgacccat
aacttgctgctaaattatggcttgtatagaaaaatggaaatatataggccccataaagcc
actgctgaagaaatgacaaaataccacagcgacgagtacatcaaatttctacgttcaata
agaccagataacatgtccgagtatagtaagcagatgcagagatttaatgttggagaggat
tgtccagtgtttgatggactctttgagttttgtcagctttcaactggtggttcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatattgatatacatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgactgtatcattccat
aaatatggggaatactttcctggaacaggagacttgagggatattggtgcaggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgaatcatatgggcag
atatttaagcctattatctcaaaagtgatggagatgtatcaacctagtgctgtggtgcta
cagtgtggtgcagactcactatccggtgatagacttggttgcttcaatttgacagtcaaa
ggtcatgctaaatgtgtagaagtcgtaaaaactttcaatttaccattactgatgcttggg
ggaggtggatacacaatccgcaatgttgctcgatgttggacatatgagactgctgttgcc
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttgccacatgcacctggcgtc
caaatgcaagctattccggaagatgcagttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaaacggatagcttgtgatgaagaa
ttctcagattctgaggacgaaggagagggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagacaagaaggaaacggaggacaaaaaaacagat
gttaaagaagaagataaatccaaggacaatagtggtgaaaaaacagataccaaaggaaat
caacatttcaagggtgacctccaatcacgtggcatataa

DBGET integrated database retrieval system