KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017152Help
Entry
103017152         CDS       T03086                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103017152 (SETDB2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103017152 (SETDB2)
Chromosome [BR:bacu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103017152 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103017152 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 688 aa AA seqDB search
MELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVKEATINNNSALIKDHT
SVTQNAQENKSSSLPSTSHEDSFPEDYTSLSTENKAIPPLENKVADFREKESSSNLSYQK
HDCSGACLMKMPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEE
VFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDTDISNGVESVPISFCNEIDNR
KLPHFKYRKTVCPRAYYLNSFSNMFTDSCDCSEGCIDITKCACLQLTARNAKTCPLSSSK
ITTGYKYKRLQRQIPTGIYECSLLCKCNRRMCQNRVVQHGPQVRLQVFKTEKKGWGVRCL
DDIDRGTFVCIYSGRLLSRSNTEKPDAIDENGKEENIMKNMFSKKRKIEVTDCEVEVIPL
ELETYPRSAVTEECPPKLHNNPKEPVLEMKCNSISRIQYHSVIRSPKTKMASIQHNGKKM
GFTSSESVTSEDNGGFKPTQVHLNSKAKEMREDSSSNQVEDSEDNPVIESDVIDITRCRE
ETPPGGRCHQTVTLDDQNEIQIQKPQEEKPPACQNQQVFCDKELPSETKNASSDSLKKFN
EGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPLVTFFTNRYVKARTELTW
DYGYEAGTMPEKEIFCQCGANKCRKKIL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggagctagaagatgatgggaaagtggatttcatatttgaacaagtgcaaaatgtgctg
cagtcactgaaacaaaagatcaaagatggatctgccacaaataaagaatacatccaagca
atgattctagtgaaggaagcaactataaataataattcagctttgataaaggatcatacg
tctgtgacccagaatgcacaggaaaacaaatcaagttcattgccctctacatcacatgaa
gactcctttccagaagactatacctctctatctacagaaaataaggcaattccccctctg
gaaaataaagttgcagactttagagaaaaagaatcatcttcaaatttatcttaccaaaag
catgactgctctggtgcctgtctgatgaaaatgccacttaccttcaagggagaaaaccct
ctgcagctaccaatcaaatgccacttccaaagacgacatgcgaagacaaactctcattct
tcagcactccatgtgagttataaaaccccttgtggaaggagtctacgaaacgtggaggaa
gtttttcgttacctgcttgagacagagtgtaactttctatttacagataacttttctttc
aatacctatgttcagttgactcggaattacccaaagcaagaagaaattgtttctgatacg
gatattagcaatggagtggaatcggtgcccatttctttctgtaatgaaattgacaataga
aagcttccacattttaagtacagaaagactgtgtgtccacgagcatattatttaaacagc
ttttccaacatgtttactgattcatgtgactgttctgagggctgcatagacataacaaaa
tgtgcatgtcttcaactgacagcaaggaatgccaagacttgccccttgtcaagtagtaaa
ataaccactggatataaatataaaagactacagagacagatacctactggcatttatgaa
tgcagcctgttgtgcaaatgtaatcgacgaatgtgtcaaaaccgagttgtccaacatgga
cctcaagtgaggctacaagtattcaaaactgagaagaagggatggggagtacgctgccta
gatgacattgacagagggacgtttgtttgcatttattcaggaagattactaagcagatct
aacactgagaaacctgatgctattgatgaaaatggaaaagaagagaatattatgaaaaat
atgttttcaaagaagaggaaaatagaagtcacagattgtgaggttgaagttatcccatta
gaattggagacatatcctagaagtgctgtgactgaggagtgtccacctaagctccataat
aatcccaaagagcctgttctagaaatgaaatgtaacagtatttcaagaattcagtatcat
tcagtcattagaagtcctaaaaccaagatggccagtattcaacacaacgggaaaaagatg
ggatttacttcctcagagtctgtcacctcagaagataatggtggatttaaaccaactcaa
gtacatctgaactctaaagccaaggaaatgagagaggactcaagctcaaaccaagttgaa
gattctgaagacaaccctgtgattgaatcagatgtgatagatataactagatgtagagaa
gaaactccaccagggggcagatgtcaccaaacagtcacactggatgatcagaatgagatt
caaatacaaaagccccaagaggaaaaacctccagcatgtcaaaaccagcaggtcttttgt
gataaagagttaccaagtgaaaccaagaatgcttcatctgattctctaaagaagttcaat
gaagggaatgtgtttttattggatgccacaaaagaaggaaatgtgggccgcttccttaat
catagttgttgcccaaatcttttggtacagaatgtttttgtagaaacacatgacagaaat
tttccattggtgacgttcttcactaacaggtatgtgaaagcaagaacagaactaacatgg
gattatggttatgaagctgggactatgcctgaaaaagaaatattctgccaatgtggggct
aataagtgtaggaaaaaaatattataa

DBGET integrated database retrieval system