KEGG   Bacillus sp. WP8: QR42_09040Help
Entry
QR42_09040        CDS       T03530                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00010  Glycolysis / Gluconeogenesis
bacw00053  Ascorbate and aldarate metabolism
bacw00071  Fatty acid degradation
bacw00280  Valine, leucine and isoleucine degradation
bacw00310  Lysine degradation
bacw00330  Arginine and proline metabolism
bacw00340  Histidine metabolism
bacw00380  Tryptophan metabolism
bacw00410  beta-Alanine metabolism
bacw00561  Glycerolipid metabolism
bacw00620  Pyruvate metabolism
bacw00625  Chloroalkane and chloroalkene degradation
bacw01100  Metabolic pathways
bacw01110  Biosynthesis of secondary metabolites
bacw01120  Microbial metabolism in diverse environments
bacw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bacw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    QR42_09040
   00053 Ascorbate and aldarate metabolism
    QR42_09040
   00620 Pyruvate metabolism
    QR42_09040
  Lipid metabolism
   00071 Fatty acid degradation
    QR42_09040
   00561 Glycerolipid metabolism
    QR42_09040
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    QR42_09040
   00310 Lysine degradation
    QR42_09040
   00330 Arginine and proline metabolism
    QR42_09040
   00340 Histidine metabolism
    QR42_09040
   00380 Tryptophan metabolism
    QR42_09040
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    QR42_09040
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    QR42_09040
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    QR42_09040
Enzymes [BR:bacw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     QR42_09040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh MtaB
Motif
Other DBs
NCBI-ProteinID: AIZ60404
UniProt: A0A0B4S8S0
LinkDB All DBs
Position
1823880..1825307
Genome map
AA seq 475 aa AA seqDB search
MRNQEKHFINGEWIASTGNETTEVINPATEEVIGTISLGTKEDLDKAVKAARAAFPSFSK
TSRNERVKMLENIVRGYEKRKDELIEVMTQELGAPLKVSEEVHYKMGHEHFSKAAEALKS
YTFTEDRGGHTIIKEAIGVSGLITPWNFPTNQTSLKIAGAIAAGSPVVLKPAEITPFAAM
ILADIINEAGVPKGVFNLVNGTGDVIGDGISSHPDIDFVSFTGSGAVGSKIMENAADNIK
KVALELGGKSPLIVLDDADVDEAAETAVHHIAMNTGQVCSAATRVLIPESMKDAFEKALL
NALPKFTVGDPREDHATGPLVSKKQWDTVQSYIEKGIQEGANLLAGGTGKPDGLDKGYFA
KHTIFTNVKNDMTIAQEEIFGPVMSVITYQDLDHALEIANDTVYGLAGYVVGKDEKTLKY
VAEHIRAGQITINNAETDYFAPFGGFKQSGIGREWGDFGIEEYLEVKAVMGLPTA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcaagagaaacattttattaacggagaatggatcgcatcaacaggaaacgaa
acgacggaagtcatcaatcctgctacagaggaagtcattggcaccattagtttaggtaca
aaagaagatttagataaggcagtcaaagctgctcgtgccgccttcccttctttctcaaaa
acatctcgaaatgaacgcgtaaagatgctggaaaacattgtgcgcggctacgaaaaacgt
aaggatgaactgatagaagtcatgacacaagagctcggtgcaccgctgaaagtatcagaa
gaggttcattacaaaatgggacatgaacatttttctaaagcagcggaagcacttaaatca
tatacatttactgaggaccgcggcgggcataccattataaaagaagcgattggtgtcagc
ggattgattacaccttggaatttcccaacgaatcaaacatcacttaaaatcgcaggtgcc
attgcagcaggttcaccagtcgtcttaaagcctgcagaaattacaccttttgccgcaatg
attcttgcagacatcattaatgaagcaggcgtaccaaaaggagtcttcaacctagttaac
ggaactggtgacgtcattggtgacggcattagctcacaccctgatattgactttgtttca
tttactggatcaggtgctgtcggctctaaaataatggagaacgctgcagacaatattaag
aaagtggctcttgagctcggcggtaaatcccctcttatcgtcttagatgatgcagatgtg
gatgaggcagccgaaacagccgttcatcatattgcgatgaatacaggtcaagtatgttcc
gcagctacacgtgtgctgattcctgaatcaatgaaagacgcatttgaaaaagcgctgctg
aatgccctgccgaagtttacagttggtgatccgcgagaagatcacgccactggcccgctt
gtctccaaaaagcagtgggataccgtgcagtcttatattgaaaaaggaattcaagaaggt
gccaatctgcttgctgggggaactgggaagccggacggactagacaaaggatattttgcc
aagcatactattttcacaaatgtgaaaaatgatatgaccattgcgcaagaggaaatattc
ggacccgtcatgagtgtgatcacatatcaagacctggatcatgcccttgagattgccaat
gatacagtgtacggtcttgctggatatgtggttggaaaagatgaaaaaacattaaaatat
gtagctgaacatattcgtgccggtcaaattaccattaacaatgccgaaacagattacttt
gccccgtttggcggctttaagcaatctggtatcggaagagaatggggagacttcggaatc
gaggaatatttagaagtgaaagctgtgatgggacttccaacagcataa

DBGET integrated database retrieval system