KEGG   Bacillus coagulans 36D1: Bcoa_1167Help
Entry
Bcoa_1167         CDS       T01628                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bag  Bacillus coagulans 36D1
Brite
Translation factors [BR:bag03012]
 Eukaryotic Type
  Elongation factors
   Bcoa_1167
 Prokaryotic Type
   Bcoa_1167
Mitochondrial biogenesis [BR:bag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bcoa_1167
Exosome [BR:bag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bcoa_1167
  Exosomal proteins of breast cancer cells
   Bcoa_1167
  Exosomal proteins of colorectal cancer cells
   Bcoa_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1255560..1256747)
Genome map
AA seq 395 aa AA seqDB search
MAKQKFDRSKEHCNIGTIGHVDHGKTTLTAAITAVLAKQGKAEARAYDQIDGAPEERERG
ITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPEYEAKILELMDAVDEYIPTPQRDTDKPFMMPVEDVFSITGRGTVATGRVERGQLKVG
DVVEIIGLNDEPKQTTVTGVEMFRKLLDYAEAGDNIGALLRGIAREEVQRGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
SVELIAPIAIEEGTKFSIREGGRTVGAGSVSAIEA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaaaatttgaccgttctaaagaacactgtaacattggaacaatcggtcac
gttgaccatggtaaaacgactttgactgctgcaattactgctgttcttgcaaaacaaggt
aaagcagaagcaagggcatatgaccaaattgacggtgctccggaagaacgcgaacgtggt
attaccatcaacactgcacacgttgaatatgaaacagaaaaacgccactacgcacacgtt
gactgccctggacacgctgactatgtgaaaaacatgattacgggtgctgcacaaatggac
ggtgcgattctggttgtatccgctgctgacggcccaatgccgcaaacgcgtgaacacatc
ctgttgtcccgccaagttggtgtgccttacattgttgtattcctgaacaaatgcgacatg
gtggacgacgaagaattgcttgaacttgttgaaatggaagttcgtgaccttctttccgaa
tacgacttccctggcgatgaagtgccggttatcaaaggttctgctttgaaagctcttgaa
ggcgaccctgaatacgaagcaaaaatccttgaattgatggatgctgttgacgaatacatc
ccgactccgcaacgtgacacagacaaaccgttcatgatgccggtggaagacgtattctcc
atcaccggtcgtggtaccgttgcaaccggccgtgtagaacgcggtcaattgaaagtcggc
gatgttgttgaaatcatcggtttgaacgacgaaccaaaacaaacaacggttaccggcgtt
gaaatgttccgcaaactgctcgactatgctgaagcaggcgacaacatcggtgcacttctc
cgcgggattgcacgtgaagaagtccaacgtggtcaagttttggcgaaaccgggttctatt
acaccgcatacaaaatttaaagcacaagtttacgtattaacgaaagaagaaggcggacgt
cacactcctttcttctctaactaccgtccgcaattctacttccgtacaacggatgttacc
ggcattattacgctgcctgaaggcgttgaaatggttatgcctggtgataacgttgaaatg
agcgttgaattgattgcccctatcgcgatcgaagaaggaacaaaattctcgatccgtgaa
ggcggccgtacagttggcgccggttctgtttccgctatcgaagcttaa

DBGET integrated database retrieval system