KEGG   Bacillus coagulans 36D1: Bcoa_3252Help
Entry
Bcoa_3252         CDS       T01628                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00020  Citrate cycle (TCA cycle)
bag00310  Lysine degradation
bag00380  Tryptophan metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
Module
bag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcoa_3252
  Amino acid metabolism
   00310 Lysine degradation
    Bcoa_3252
   00380 Tryptophan metabolism
    Bcoa_3252
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Bcoa_3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: AEP02424
UniProt: G2TMC6
LinkDB All DBs
Position
complement(3453480..3456314)
Genome map
AA seq 944 aa AA seqDB search
MNATTPKGFWESFSGPNLGYVMDLYEQYLEDPESIDEEARKVFDQWGAPAVSEGGSPTQG
QADISFQLPANPTIFSKMVAAVKLADNIRTFGHLAADINPLQKPVGDVRRIELGEFDLTE
EDLKKVPASFICPDAPKRVKNGLDAINYLKEVYTQKVAFEFDHIHDMEEKHWLQRTVESG
SFFRELSRKQKIGILKRLSDVEGFEKFIHRTFVGQKRFSIEGLDALVPLMEQMIIEAVKT
GVKTVNIGMAHRGRLNVLAHILEKPYELIFAEFKHASNKDLIPSEGSIGITYGWTGDVKY
HLGADRKGQNGGPIGARIVLANNPSHLEVADPVVEGYTRAAQDNRNKTGYPDRDPDRAFA
ILVHGDAAFAGQGIVAETLNMSKLNGYGTGGTIHIIANNNIGFTTETYDSRSTKYASDPA
KGYEVPILHVNADDPEACVQAALFAYAYREKFHKDFVIDLVGYRRYGHNEMDEPMVTNPV
MYHAVHNHPTVRAIYGEQLAKEGVLTAEEVKTIDEAVQKKLQAAYEKVPDGEAEPDTAME
PPENVKKGYLSMETGVPEQELRAWNAELLAWPENFHVFKKLARILKRREHVFDGKGKIDW
AHAEALAFAAILKDGVPIRFTGQDTQRGTFAQRNLVLHDEQTGEEYIPHHHLSGVQTSFA
IYNSPLTEAGVVGFEYGYNVFSPDTLVIWEAQFGDFANMAQVMFDQFISSGRAKWGQKSG
LVMMLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANVSTAGQYFHILRRQAKWLAKEEI
RPLVLMTPKSLLRHPLASVEPSVLTDGKFHTVLEGPGTKNTDAVERILLCSGKVAVDLEE
KLNSAENTSWLHTVRVEQIYPFPEQELKEIFARFKNAKEIVWMQEEPKNMGSWSFVEPYL
RKLAPQGAEIRYIGRPRRSSPSEGDPVVHKKEQNRILTEAITRP
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaactacaccaaagggattttgggaaagtttttccgggcctaatcttgggtat
gtcatggatttatatgaacaatacctggaagatccggagagcatcgacgaagaggcgaga
aaagtatttgaccagtggggcgcgcccgctgtttccgaaggcgggagcccgacacagggg
caggcggatatttctttccaattgccggcaaacccgacgattttcagcaaaatggtcgct
gccgtcaaattggcggacaatatccggacttttggccatctcgcagcggatatcaacccg
ctccaaaaacctgttggggatgtcagaagaattgaactgggagaatttgatttaaccgaa
gaagatttgaaaaaagtgccggcatcctttatttgcccggatgcacctaaaagggtcaaa
aacgggcttgatgccatcaattatttaaaagaagtgtacacccaaaaagttgcctttgag
tttgaccatattcacgacatggaagaaaagcactggctgcaacggactgttgaatcgggc
agctttttccgcgaactcagccggaaacagaaaatcggcattttaaaacgcctttccgat
gtggaaggatttgaaaaatttatccaccggacatttgtcgggcaaaagcgtttttccatt
gaagggcttgatgcgctcgttccgctgatggaacaaatgattattgaagcggtaaaaaca
ggtgtgaaaaccgttaatatcggcatggcgcacagaggccgcctcaatgtgcttgcccat
attcttgaaaaaccgtatgagctcatttttgcagaattcaagcatgcttccaataaagat
ttaatcccttccgaaggatcgatcggcattacgtacggatggaccggcgacgttaaatac
catctcggcgcggacagaaaagggcaaaacggcggaccgatcggcgcgcgcatcgtactt
gccaacaatccaagccatttggaagttgccgatcctgttgtcgaagggtatacacgcgcc
gcgcaggataaccggaacaaaacgggctatccggaccgcgatccggaccgcgcctttgcg
attcttgtccacggggatgccgcatttgcggggcagggcattgtcgcagaaacgctgaac
atgagcaagctgaacggatacgggacaggcgggacgatccatatcatcgccaataacaat
atcgggtttacgaccgaaacgtatgactcgcggtcaacgaaatatgcttccgatccggca
aaaggttatgaagtgccgatcctccatgtgaatgcggatgatccggaagcatgcgtacag
gcggcgctgtttgcgtatgcttaccgcgaaaaattccataaagattttgtgatcgaccta
gtcggctaccgtcgctatggtcataacgaaatggatgaaccgatggtaaccaacccggta
atgtaccatgcagtgcacaatcatccgacggtcagggccatttacggtgaacagcttgca
aaagaaggcgtcctgacagccgaagaggtcaaaaccatcgatgaagccgtccagaaaaaa
ctgcaggcggcttacgaaaaagtgccggacggcgaagcggaacccgatacggccatggaa
ccccctgaaaatgtgaaaaaaggttatttgagcatggaaacaggggtgccggaacaggaa
ctgcgggcttggaacgctgaattgctcgcctggcctgaaaacttccatgtctttaaaaaa
ctggcgcggattttgaaacgccgcgaacacgtctttgacggcaagggaaaaattgactgg
gcccatgcggaagcgctcgcgtttgcagccattttaaaagatggcgtgccgatccggttt
accggccaggatacacagcgcggcacgttcgctcagcgcaatctcgtcctgcacgacgaa
cagacgggggaagaatacattccgcaccatcatctgtccggcgttcaaacttcatttgcc
atttataacagtccgctgactgaagctggcgtcgttggctttgaatacggctataacgtc
ttttcgccagatacgctcgtcatttgggaagcccagttcggcgattttgcaaacatggcg
caagtgatgtttgaccagttcatttcatctggcagggcaaaatgggggcaaaaatcaggg
cttgtcatgatgctgccgcacggatacgaaggacagggtccggaacattcaagcggcagg
gtggaacgcttcctgcaactggcagcggaaaacaactggacagtggcaaatgtttcgaca
gccggccaatacttccatattttaagaaggcaggcaaaatggctggcaaaagaagaaatc
cgcccgctcgttctcatgacgccaaaaagcctgcttcgccacccgctggcatctgtagag
ccgtctgtactgacggacggaaaattccacactgtgctggaaggcccgggtacgaaaaat
acggatgcagtcgaaagaatcctgctttgcagcgggaaagtggctgtagacttggaagaa
aagctgaacagtgcggaaaataccagctggctgcatacggtaagggttgagcaaatttat
cctttccctgaacaggaattaaaggaaatcttcgcgcgctttaaaaacgcgaaagaaatt
gtatggatgcaagaggagccgaaaaatatgggttcctggtctttcgttgaaccgtattta
agaaagctggcgcctcagggagcggaaatccggtacatcggccggccgagaagatcaagc
ccgtcggaaggcgacccggtcgtccataaaaaggaacaaaacagaattctgactgaagcc
attacccgcccttaa

DBGET integrated database retrieval system