KEGG   Bacillus anthracis CDC 684: BAMEG_4216Help
Entry
BAMEG_4216        CDS       T00886                                 

Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bah  Bacillus anthracis CDC 684
Brite
Enzymes [BR:bah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BAMEG_4216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3825957..3826787
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEIYSFRTSDELSFDLNLRVNIITSA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEKETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYALNERRVPYAFISAFLTDTITRIDSR
LMSYHASPSTPQTSIGFIPIRDDAIVATVGNTTTVY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggccgttctattgtacatccttatatcacaaatgaatatgagccattt
gcagctgagaaacaacaaattttatctataatggcaggaaatcaagaaatctattccttt
cgaacatccgatgaactcagctttgatctaaatttgcgcgttaatattattacttctgca
ttagaactttttcaaagtggttttcagtttcgcacatttcaacaatctttttgcaaccct
caatattggaaaagaacgtctcttggaggattcgagctccttccaaacatacccccttcc
attgccatacaagatattttcaaaaacggaaaactatatggaactgaatgtgccaccgct
atgatcattattttttacaaagctttactatcattgtatgagaaagaaactttcaaccgt
ctctttgcaaaccttttactttatacgtgggactacgatcaagatttaaagctcataaca
aagacaggtggcgatcttgtcccaggtgatctcgtttactttaaaaatccacaagtgaat
ccagctacaatcgagtggcaaggagaaaatacaatctatctaggaaatttctttttttat
gggcatggcgtaggtgtaaaaacaaaagaagaaattatatacgcattaaatgagcgacga
gtcccttacgcttttatttctgctttcttaaccgatactattacccgtattgatagccgt
ctcatgagctaccacgcttctcctagtacaccacagacatccataggatttattccgatt
agagatgatgcaatcgttgcaacagttggcaacacaactacagtttattaa

DBGET integrated database retrieval system