KEGG   Bacillus cereus biovar anthracis CI: BACI_c39200Help
Entry
BACI_c39200       CDS       T01279                                 

Gene name
tgl
Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bal  Bacillus cereus biovar anthracis CI
Brite
Enzymes [BR:bal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BACI_c39200 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3731023..3731853
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEIYSFRTSNELSFDLNLRVNIITSA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEEETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYALNERRVPYAFISAFLTDTITRIDSR
LMSYHASPSTPQTSIGFIPIRDDAIVATVGNTTTVY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggccgttctattgtacatccttatatcacaaatgaatatgagccattt
gcagctgagaaacaacaaattttatctataatggcaggaaatcaagaaatctattccttt
cgaacctctaatgaactcagctttgatctaaatttgcgcgttaatattattacttctgca
ttagaactttttcaaagtggttttcagtttcgcacatttcaacaatctttttgcaaccct
caatattggaaaagaacgtctcttggaggattcgagctccttccaaacatacccccttcc
attgccatacaagatattttcaaaaacggaaaactatatggaactgaatgtgccaccgct
atgatcattattttttacaaagctctactatcattgtatgaggaagaaactttcaaccgt
ctctttgcaaaccttttactttatacgtgggactacgatcaagatttaaagctcataaca
aagacaggtggcgatcttgtcccaggtgatctcgtttactttaaaaatccacaagtgaat
ccagctacaatcgagtggcaaggagaaaatacaatctatctaggaaatttctttttttat
gggcatggcgtaggtgtaaaaacaaaagaagaaattatatacgcattaaatgagcgacga
gtcccttacgctttcatttccgctttcttaaccgatactattacccgtattgatagccgt
ctcatgagctaccacgcttctcctagtacaccacagacatccataggatttattccgatt
agagatgatgcaatcgttgcaacagttggcaacacaactacagtttattaa

DBGET integrated database retrieval system