KEGG   Bacillus altitudinis: CFN77_10050Help
Entry
CFN77_10050       CDS       T05199                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
balt  Bacillus altitudinis
Pathway
balt00020  Citrate cycle (TCA cycle)
balt00310  Lysine degradation
balt00380  Tryptophan metabolism
balt01100  Metabolic pathways
balt01110  Biosynthesis of secondary metabolites
balt01120  Microbial metabolism in diverse environments
balt01130  Biosynthesis of antibiotics
balt01200  Carbon metabolism
Module
balt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
balt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:balt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFN77_10050 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    CFN77_10050 (sucA)
   00380 Tryptophan metabolism
    CFN77_10050 (sucA)
Enzymes [BR:balt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CFN77_10050 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N Herpes_UL21 PFOR_II
Motif
Other DBs
NCBI-ProteinID: ATH72536
UniProt: A0A0B0QG40
LinkDB All DBs
Position
complement(1977679..1980513)
Genome map
AA seq 944 aa AA seqDB search
MFQNDVKQPLSWEEFHGPNLGYVLELYDQYVQDPTSVDEDIRGIFDELGAPPSEMKEEIG
KKENSVVTSEQIQKIASVVKLAEDIRTYGHLNASVNPLRKEKELQELFPLKEYGLTEEDV
KNIPISIISPDAPKHISNGIEAINHLRNTYKRTISFEFDHVHDFEERNWLSKSIESGELF
KKKPADKLVSVFKRLTEVEQFEQFLHKTFVGQKRFSIEGLDALVPVLDEIISESVTQGTS
NINIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKELVPSEGSIGISYGWTGDVKYHLG
ADRQIKDEDTKSARVTLANNPSHLEFIDPIIEGSTRAAQESRTQKGYPVQDVEKALAILI
HGDAAFPGEGIVAETLNLSQLVGYQVGGTIHIIANNMIGFTTESNESRSTKYASDLAKGF
EIPIVHVNADDPEACLAAVQLAVEYRKRFKKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHKTVKNIFADKLVTEGLLSKEQREEIEQAVTAKIEEAYKKVPSKKEHTIQEIELPE
PVSNGFPAVDTSVEFDVLRKLNEELISWPKDFQVFGKLKRILEKRAKVFTDDRKVEWSLG
EALAFASILKDGTPIRMTGQDSERGTFAQRNLVLHDSQTGDEFIALHELSDANASFTVHN
SPLSEGSVIGFEYGYNVYSPETLVIWEAQFGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRTERFLQSAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTLSEVQELTDGQFRPVLEQPGLVHDHEKVTRLVLSSGKVSIDISDRF
TQMEDSKDWLHIARVEQLYPFPAKDIKAILSKLTNLEEIVWVQEEPQNMGAWGYIEPYLR
EIASEKVKVRYIGRRRRSSTAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatgatgtgaaacaaccgttgagttgggaagaatttcatggtccgaacctc
ggctacgtgctcgagctctacgatcaatatgtccaggatcctactagtgttgatgaagac
ataagaggcatatttgatgaacttggtgcaccaccgagtgaaatgaaggaggaaattggg
aaaaaagaaaatagcgtagttacttctgaacaaatccaaaagatagcatcagtcgttaaa
ctggcagaagacatcagaacgtatggccatttaaatgcttccgtcaatcctcttcgcaaa
gaaaaggaattacaagagctgtttccattaaaggaatacggtttaactgaagaagacgtt
aagaatattccaatatcaattattagtccagatgcacctaaacacatttcaaacggcata
gaagccattaaccatttgagaaatacgtataagcgtaccatttcatttgagtttgatcac
gtacatgacttcgaagagcgcaactggctctctaaatctattgagtctggtgaattattt
aagaaaaaaccagcagataaactagtttctgtattcaaaagattaacagaagtcgagcaa
tttgagcagttccttcataaaacatttgttggacaaaagcgtttttctattgaaggatta
gacgcacttgttccagtacttgatgaaattatatccgagtctgttacacaagggacttca
aatattaacattggaatggcacatagaggccgtttaaatgtattagcacatgtgttagga
aagccatatgagatcattttctcagaattccagcatgcgcctaataaagagcttgtacca
tcagaaggctctatcggcatcagctacggatggacaggggatgtaaaatatcatctcggt
gctgaccgccaaatcaaagatgaagatacaaagagtgcaagagtcacacttgccaataac
ccaagtcacttggaatttattgacccgattattgaaggaagcactcgtgcagctcaagaa
tcgcgtactcaaaaaggctatccagttcaagacgttgaaaaagcgttagccatcttaatt
catggggatgctgcatttcctggagagggaattgtcgcagaaacattaaatttaagtcaa
ttagtcggctatcaagtggggggaacgatccatatcattgccaacaatatgattggattt
accacagaaagcaatgaatctcgttcaactaaatacgctagtgaccttgcaaaaggtttc
gagattccaattgttcacgtcaatgcagacgatccagaagcttgtttagcagctgttcag
ctggcggtagaataccgtaaacggtttaaaaaagatttcttaattgacttgattggctac
cgcagatatggccataacgaaatggatgagccatctactactcagccaatgctgtacgat
gcggtcagaaagcacaaaacggtcaagaatatcttcgcagataagcttgtcactgagggc
cttctgtcaaaagaacaaagagaagaaattgagcaggctgtcacggcaaaaattgaagaa
gcttataaaaaagtgccttcaaagaaagaacatacgattcaagaaatcgaactgccagag
cctgtatctaacggcttccctgcagttgatacatctgtagagtttgatgtattaagaaag
ctgaatgaagaattaattagctggccgaaagacttccaagtattcggtaagctaaagcgg
atccttgaaaaacgtgcaaaagtgtttacagatgatcgcaaagtggaatggtcacttggt
gaagcactggcatttgcatctatattaaaagacggtacgccgattcgaatgaccggacag
gattctgagcgaggcacatttgctcaaagaaaccttgttcttcacgacagtcaaacggga
gatgaattcattgctcttcatgaactgagtgatgcaaatgcatcatttacagtccataat
agtccactgtcagaaggctctgtcatcgggtttgaatatggttataatgtctattctcct
gaaacattagtgatttgggaagctcaatttggagacttcgcaaatgcggctcaagtgtat
tttgatcaatttatttcagcaggccgcgccaagtggggacaaaagtcagggcttgtgatg
ctcttgccacatggatatgaaggacaaggtccagaacattctagtggaagaacagaacgc
ttcttgcaatcagctgctgagaataactggacagttgcgaatctgacaagtgcagctcaa
tacttccatattcttagaagacaggcgaaaatgctgcttcgtgaagagattcgtcctctt
gtcatcatgacaccgaagagtctgcttcgtaacccgaacacattatccgaagtccaagaa
ctaacagatggacagttccgtccagttcttgaacagccgggccttgtgcatgatcatgaa
aaagtaacacgccttgtgctatcgagcggaaaggtatcgatcgatattagtgatcgtttt
actcaaatggaagactcaaaagattggcttcatattgcgagagtggaacaattatatcca
ttcccagccaaagatattaaagccattttatcaaaactgacgaacttagaagaaatcgta
tgggtgcaagaagaaccgcaaaatatgggtgcttggggatatattgagccatatttacgt
gaaattgcatctgaaaaagtaaaagtacgttacatcggccgcagaagacgttcaagtacg
gctgagggtgatccaactgttcataaaaaagaacaagaacgaattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system