KEGG   Burkholderia ambifaria AMMD: Bamb_0252Help
Entry
Bamb_0252         CDS       T00398                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bam  Burkholderia ambifaria AMMD
Brite
Translation factors [BR:bam03012]
 Eukaryotic Type
  Elongation factors
   Bamb_0252
 Prokaryotic Type
   Bamb_0252
Mitochondrial biogenesis [BR:bam03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bamb_0252
Exosome [BR:bam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bamb_0252
  Exosomal proteins of breast cancer cells
   Bamb_0252
  Exosomal proteins of colorectal cancer cells
   Bamb_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:298436..299626
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggtaaatttgagcggaccaagccgcacgtcaacgttggaacgatcggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgacggtgctgacgaagaagttc
ggcggcgaagcgaaggcttacgaccagatcgacgcggcaccggaagaaaaggcgcgcggc
atcacgatcaacacggcacacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcgatcctggtttgctcggcagcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggcaaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgagcctggcagacgcactggacacg
tacatcccgacgccggagcgtgcagttgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggtacggtggtgacgggtcgtgtcgagcgcggcatcgtgaag
gtcggcgaagaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccaaggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgctccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggtggccgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system